KEGG   Paracoccidioides brasiliensis: PAAG_00772Help
Entry
PAAG_00772        CDS       T02230                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
pbl  Paracoccidioides brasiliensis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PAAG_00772
Translation factors [BR:pbl03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    PAAG_00772
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 285 aa AA seqDB search
MAPSKWDDEEESTPPSSPPLSAAIPIAQRRKFDDEEDSDNVVDDWEAAEDSEVEREKAAK
AAAEKAKAEAEAAAKKKSRAQRIQQRREQRRLEEDEEDDDSDDDDPAAQRARLRRTEKDA
DLKHAEDLIADIDLNRSLNRSATKATVIHLSETGDNSDPTQRAIDLSSIPLFRPATKAQF
TELTEALIPLLTAQSKKPQYALWVQDFTKKLVKELGSGDIKKVASVLTAASNEKLKEEKA
AEKGGKKSKAAKTKTSVVVGRDMGVGGKADITAYDGDDLDDDDFM
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgtcaaagtgggatgatgaagaggagagcaccccgccctcttccccaccttta
tctgctgctatacctatagcccagagacgaaaattcgatgacgaagaggatagcgacaat
gtcgtagatgattgggaagctgccgaagattccgaagttgagcgtgaaaaagccgccaaa
gcagctgccgaaaaagccaaagcagaggccgaagccgccgccaagaaaaaatcccgggcc
cagcgcatacagcaacgtcgagagcaacgacggctggaagaggacgaagaggacgatgac
agcgatgatgacgaccccgctgcccaacgcgcccgtctccgccgtacagagaaggacgca
gatctcaaacacgccgaagacctaatcgccgacatcgacctgaaccgctccctcaaccgc
tccgccacaaaagcaacagtaatccacctctccgaaactggcgataatagcgatcccacc
caacgagccatagacctctcctccatcccgctcttcagacccgctacaaaggcgcagttc
acggaattaacagaagcgcttataccgctgctgacagcgcagtcgaagaagcctcagtat
gcgctgtgggtgcaggatttcacgaaaaagttggtgaaggagttggggagtggggatatt
aagaaggttgcgtctgtgttgacggcggcgagcaatgagaagttgaaggaggagaaggcg
gcggagaagggagggaagaagagcaaggcggctaagacgaagacgagcgttgttgttggg
agggatatgggggttggtgggaaggcggatattacggcgtatgacggggatgacttggat
gacgatgattttatgtga

DBGET integrated database retrieval system