KEGG   Paracoccidioides brasiliensis: PAAG_00783Help
Entry
PAAG_00783        CDS       T02230                                 

Definition
serine/threonine-protein phosphatase PP1
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
mRNA surveillance pathway
Meiosis - yeast
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:pbl03015]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:pbl04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 325 aa AA seqDB search
MADQNEIDLDSIIDRLLEVRGSRPGKQVQLLESEIRHLCTKAREIFISQPILLELEAPIK
ICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFI
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDL
NSMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKHD
MDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAE
KKQKYVYGGMSSGRPITPPRKQKKK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccagaatgaaatcgatctcgattccatcatcgaccggctgttggaggtgagg
ggtagccgaccaggaaagcaagttcaattgctcgagtctgaaattcgccatctctgcacc
aaggccagagagattttcatatctcagcctatactgctggaacttgaggccccaatcaag
atatgcggcgatatccacggacaatattacgatctcctgcgtttattcgagtacggcggg
tttcctcccgaggctaactacctcttccttggagactacgtagatagaggtaaacaatca
ctcgagaccatctgtctgctattggcgtacaagatcaagtatccagagaattttttcatc
ctccgcggaaaccatgagtgtgcgtctatcaaccgtatttatggtttctatgacgagtgc
aaacggagatacaacatcaagctgtggaagaccttcacggactgcttcaactgtttgcca
atcgcagccatcatagacgagaaaatcttcaccatgcacggcggcctcagccctgatttg
aactccatggaacaaatccgtcgtgtaatgcgtcctactgatattcccgattgcggtctt
ctctgtgatctcttgtggtctgatccggataaggatataactggctggagcgaaaacgat
cggggcgtgtcgttcacgtttggtccggacgttgtttcacgattcctacaaaagcacgat
atggaccttatatgtcgtgcacatcaggttgttgaggatggttatgaatttttctcgaag
cgacagctagtcacactctttagcgcgcccaactattgtggagaatttgacaatgctgga
gctatgatgagtgttgacgagagtctgctatgttcatttcagattttgaaaccagccgaa
aagaaacaaaagtacgtctacggtggcatgagcagtggcagacccattactcctcctagg
aagcaaaagaagaagtga

DBGET integrated database retrieval system