KEGG   Paracoccidioides brasiliensis: PAAG_00848Help
Entry
PAAG_00848        CDS       T02230                                 

Definition
histone-lysine N-methyltransferase
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    PAAG_00848
Enzymes [BR:pbl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     PAAG_00848
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1164 aa AA seqDB search
MSRVSAGFADFFPTAPSVLQKKRSSKAAQDRPKGKLKHDDGPRSANPPSSSAIAATAEPA
AIRAAEDGGASGINTTNHGDPPIQSSDNILVDESVPVVHGDANVTPGDTNGVASASSTST
GSSVFSSASLPQPGAAISNGITHPHALTPLTNTDSSPPCKPGSPSTGLKSIAVGGESVLP
SRLVDDVKATITPLQTPPTPQSQARPAGNAPKGCKLTYDPDLEKKPATREKRRKPQYEVF
GTTEDEPPPTDPRLAIANYTRGAGCKQKTKYRPAPYILRPWPYDPATSVGPGPPTQIVVT
GYDPLTTLAPISALFSSFGDIAEIKNRTDPNTGRFLGVCSIRYKDSRMFRGGGPLLAAQA
ARRAYLECKKEQRIGTRRIQVSLDRDGVVSDRLVAKIIGSQKQDTPPVILEEKPKPPETD
NLPPPTAPKGPSRKPNLPIPEGPRAALKPPAPSVIEETPILDQIKREPYIFIAHCYVPVL
RTTIPHLERRLKLFNWKSVRCDKTGYYIIFENSRRGEEETERCYKMCHMTALFTYVMNME
SQPYGNPNYVRSPSPERLKAEQKEEAEKDRLKREDELDIEEEKKLRAADLDPAREVLRVL
VSELRDKLLEDVKSRIAAPALYDYLEPDRHAARRQKLGIPEPDSNKRPAFRIGTSDEIIA
GIPNSREVPLAKSRAPFGPSSILSLPRIRKTQGLENANDAFMDERRRRPPRRREFRPLYH
RLQQLHEDEDSDDERRTTFTRDTDEQESRSLSRMSMASSDSENEDEFGTTVEDRGLFGDE
PMGTDDMLEIDLKTIKDATVDELERSMLNLSPVSKKRKRISEELEARKRQKEDDELFGLI
DSKPGEQTKPGVDELEEVAVIEPITQVKAKKPKAKKKSKKQIFEEREALKLKQLDNAEQV
PLKDDILVETSPVEEEKAIEDVIPKFVEEARPEVEWGVSRDVPRPTVEDDETIILDLDGW
QNLIKDDEDIRFLREALEDQQPSNLGNVSSWAWRQKEIKAINRGGETGPVHSETKIEGYY
VTNSTGSARTEGRKRILESEKSKYLPHRIKVQKAREEREALAKADPQAAAAEAARLAAAK
TISKSTSRSTRVNNRRLIADINAQKQALPMQSGESDVLRFNQLKKRKKPVRFARSAIHNW
GLYAEENISANDMIIEYVGEKTKN
NT seq 3495 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcgtgtcggcaggtttcgcagacttctttcccactgctccctcagtcctccag
aagaagcgctcctccaaggctgcccaggaccgaccaaagggcaagcttaagcacgatgat
ggtccccggtctgccaatccaccatcatcctccgctattgccgccactgcagaaccagca
gcaataagagcggcggaggatggtggggcctcaggcatcaataccactaaccacggtgac
cctccaatccaaagcagtgacaatattctagttgatgaatctgtccccgtggttcatggg
gatgcaaatgtaactcctggtgatacgaacggggtggcctcagccagttcgactagcact
ggttcctctgtgttcagctcagcctctctccctcaacctggggccgcgatttcaaacgga
ataactcaccctcatgccctcacccctctaaccaacacagattcgtcacctccgtgtaaa
cctggcagcccgtcaacaggtttgaaatcaattgctgtgggcggcgaatccgtgctccca
agtcggctggttgatgatgtcaaagccaccatcactcctctccagactcccccgactccc
caaagccaagccagacctgctggaaatgcccccaagggttgcaaactgacctatgacccc
gatttggaaaagaaaccggccaccagagaaaagcggcgaaaaccgcagtatgaagtcttt
ggcaccacagaagatgaaccaccacctacagacccgcgccttgcgattgccaattacact
cgtggtgcaggatgcaaacaaaaaacgaaatatcgaccagcgccatacattctccgtccg
tggccgtatgatcccgccacttctgtcggacccggtcctccaacacaaattgtggtgacc
ggctatgaccctttgactactctagcaccgatcagcgctctcttttccagctttggagat
atcgcagagatcaaaaacaggacggatcctaacacaggtcggtttctgggtgtctgctcc
ataagatacaaggattcgagaatgtttcgcggtggcggccctctcctcgcggcgcaagct
gcccgaagagcgtatctcgaatgtaaaaaggaacagcgtattggaacgcgccggatacag
gtcagcctcgatcgtgacggtgtcgttagcgaccggctcgttgcgaagattatcggatct
cagaaacaggataccccgcccgtaatattggaagagaaacccaaaccacctgaaaccgat
aaccttcctccgcccacagcacccaagggcccctctcgaaaacctaacttgcctataccc
gaaggcccacgagctgcgctgaagccccctgccccctccgtgatcgaagagacccccatc
ttagaccagatcaaacgtgagccttacatatttattgcacactgctacgtccctgtgctt
cgtactacaattcctcacctggaaaggcgattaaaacttttcaattggaagtctgttcga
tgcgacaaaaccggatactacataatttttgagaactcccggaggggtgaggaggagacg
gaacgatgctacaaaatgtgccatatgaccgctttgtttacatatgtgatgaacatggag
agccagccgtacggtaatcctaattacgtccgcagtccaagtcctgagcgactcaaggca
gagcaaaaggaagaggcagagaaggatcggctaaaaagagaggatgaattggatattgag
gaggagaaaaagctacgcgcagctgacctcgatccagctcgagaggtgcttcgtgttctt
gtttcagagctgagagacaaactgctggaagatgtcaagtcccgaatagctgctcctgcg
ctctacgactacctcgaacccgatcgccatgccgctaggagacagaaattaggaattccc
gaacccgatagtaataagcggcccgcttttcgaattggcacttccgacgagatcattgct
ggaatcccaaattcacgcgaggtgcctttggctaagagccgggcgccgtttggtccttcg
agtatcctctccctccctcgtatccgcaagacacaaggtttggaaaatgccaacgacgct
ttcatggatgaacggcgaaggcgtcccccaagacgaagggagttcagacctctttaccat
cgcctacagcagcttcatgaagatgaggactcggatgacgaacggagaacgacatttact
cgggacacggatgagcaagagagtcgatcactcagccgcatgagtatggcttcgtctgat
tcggagaatgaggatgagtttggtactactgtggaagatcgggggctctttggtgatgaa
cctatgggcactgatgatatgctggaaattgatctcaaaactattaaggatgcaactgtc
gacgaactcgagcgtagtatgttgaatctctcacctgtctcgaagaaaagaaagaggatt
tctgaagagcttgaggctcgtaagaggcaaaaggaagatgatgagctgttcggccttatc
gattcgaagcctggcgagcagactaagcccggagttgatgagctggaggaagttgcagtc
atcgaaccaatcactcaggtcaaggccaagaagcccaaagcgaagaagaagtccaagaaa
caaatcttcgaggagcgcgaggcattgaaattaaaacaactggataatgctgaacaagtt
cctctcaaagatgatatactggttgaaacttcaccggtggaggaagaaaaagcgattgaa
gatgttattccgaaattcgttgaagaggcaaggcccgaagttgagtggggcgtttctaga
gacgttcctagaccaactgtcgaggacgatgaaactatcatcctggatcttgacgggtgg
cagaatcttattaaagatgacgaggatatccgcttcctccgcgaagccttggaggaccaa
caaccatcgaacctcggaaacgtatcctcctgggcctggagacaaaaagaaatcaaagct
atcaatcgtggtggtgaaacaggacccgtccattccgaaaccaagatcgaaggttattac
gtcaccaactcgaccggatcagctcgcacagaaggaaggaaacgcatcctcgaatctgaa
aaatcgaaataccttcctcaccgcattaaagtacaaaaggcccgtgaggaacgtgaggca
ctggcgaaagcagacccgcaagccgccgccgcagaagccgccagactcgccgccgccaag
acaatatccaaatccacttcccgctcgacccgcgtgaacaaccgccgtcttatcgccgat
atcaatgcacagaaacaagccctgcccatgcagagcggcgagagcgacgtactccgcttc
aaccagctcaagaaacgcaagaaacccgtgcgctttgctcgttccgctatacacaactgg
ggtctgtatgctgaagagaacatctccgccaacgacatgataatcgagtatgttggtgag
aagacgaagaactga

DBGET integrated database retrieval system