KEGG   Paracoccidioides brasiliensis: PAAG_00986Help
Entry
PAAG_00986        CDS       T02230                                 

Definition
disulfide isomerase Pdi1
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PAAG_00986
Enzymes [BR:pbl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PAAG_00986
Exosome [BR:pbl04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PAAG_00986
  Exosomal proteins of colorectal cancer cells
   PAAG_00986
  Exosomal proteins of bladder cancer cells
   PAAG_00986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 538 aa AA seqDB search
MWQFRHFAFGLAGLGIAVLASAADEAASDVHALKGAAFKDFIKEHELVLAEFYAPWCGHC
KALAPEYETAATQLKEKNIPLVKVDCTEETELCQEYGVEGYPTLKVFRGLEQVKPYSGPR
KSSSITSYMVKQSLPAVTVVTVDNLEDVKTLDKVTIIGFFAQDDKATNETFTSLAEALRD
NFPFGATNDAKLAAAEDVKQPSIVLYKDFDEGKTVYKGELTQEQVTSFIKLSSTPLIGEL
GPHTYAGYIEAGIPLAYIFAETPEEREEFSKMLKPIAEKQKGSINIATIDAKAFGAHAGN
LNLKADKFPAFAIQDPVNNKKYPFDQELKITHDTIATFVQDVLDGKVEPSIKSEPIPEKQ
EGPVTVVVARSYQELVIDNDKDVLLEFYAPWCGHCKALAPKYEQLAQLYADNPEFAAKVT
IAKIDATANDVPEEIQGFPTVKLFAAGSKDKPFDYQGLRTIQGLADFVRDNGKHKVDAYD
ESKVNEDDDDDDDDDVTSTPASPSSSSTKTAEKKKDSKTTSSAAPKDTAAESARHEEL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagtttagacattttgcctttggcctagctggcctgggcatcgcagtcctggct
tctgctgctgatgaggctgcatcggatgtgcatgccctcaaaggggccgcattcaaagac
tttatcaaagagcacgagttagtcctagcggagttttatgccccatggtgtggccactgc
aaggctcttgcccccgaatatgaaactgccgctacccaactcaaggagaagaatattcct
cttgtcaaggttgattgcaccgaggagactgagctctgtcaagaatacggcgtggaaggt
taccccacgctgaaggtattccgtggattggaacaggttaaaccgtactctgggcctcgc
aagtcctcatccatcacgtcatatatggtcaaacagtcccttccagcagtcaccgtcgta
accgtcgataacttagaggatgtgaagactctggacaaggttacaattattggattcttc
gcccaggatgacaaggccacgaacgaaaccttcacctctctggctgaagcccttcgtgac
aatttcccctttggtgcaacaaatgatgccaagttggccgctgctgaagacgttaaacaa
ccatcgattgtcctgtacaaggacttcgacgagggcaagactgtttataagggcgaactt
actcaagaacaggtcaccagcttcattaagctttccagcacgcctcttattggcgagctt
ggaccacatacctatgctggctatattgaggctggcattccacttgcctacatcttcgct
gaaacccccgaggagcgtgaggaattcagcaagatgttgaaacccatcgcggaaaagcag
aagggttccatcaacattgccaccattgacgcgaaagctttcggagctcatgccggaaac
ttgaaccttaaagccgacaaattcccagccttcgccatccaggaccctgtaaacaacaag
aaataccccttcgaccaggagctgaagatcacccatgacactatcgccacgttcgtccag
gatgtcctggatggtaaggttgagcctagcatcaagtccgagcctattcccgagaagcag
gagggcccagtcacagttgtcgttgcccgcagctatcaggaactcgtcattgacaacgac
aaggacgttctccttgagttctacgccccatggtgtggccactgcaaagctctcgcacct
aaatacgagcaacttgcccagctctacgccgacaaccccgagttcgccgccaaggtcacc
atcgccaagatcgatgccaccgccaacgatgtcccagaagagatccagggtttcccaacc
gtcaagctcttcgccgccggttccaaggacaagccattcgactaccagggtttgcgaacc
atccagggtctcgccgactttgtccgggacaatggcaagcataaggtcgacgcttatgat
gagtcaaaggtcaatgaggatgatgatgatgatgatgatgatgatgtcactagcacacct
gcctctcccagctcttcatccaccaaaaccgcagagaagaagaaggatagcaagactaca
tcctcagcagctccaaaggacactgctgctgaaagtgctcgtcatgaggagctgtaa

DBGET integrated database retrieval system