KEGG   Paracoccidioides brasiliensis: PAAG_01134Help
Entry
PAAG_01134        CDS       T02230                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PAAG_01134
Enzymes [BR:pbl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PAAG_01134
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 589 aa AA seqDB search
MSQRCLFCCTLDELWAHARPRLHPWARSKRWFTTRRPASFRRFSSAPATNQKNIAVIGAG
VTGLSTAYRLSQDKNARVTVYEKSHRLGGWLQSEIIDVDGRDVLFEYGPRTLRAGYRGSL
STLELLFDLGLKNDILATKNDSPAACNRYIYYPDHLVRLPGPYPGYGSLANILMNVIQLC
TEPVLWKLAVEVIRDPSRQERDRSITDESIGDFMKRCFGPNVADVVGSAFFHGIYAGDLY
RLSARTILRIAWDEFQLSERGFATELMEYINKKRFTMPYDIFKARQLVSKEKITDICNFA
AGNNVFTLRRGLGQLATSLESSLRSAPNVEIQTGSQIKYISKGVDPSPMTLALADGTTSN
FDFIISTTPSTELSNQLLNSPTHPPPTAVTNILNQNDYAVAVMVVNLYYKNPNLFPHRGF
GYLIPRSIPFDLNPERALGVIFASDSSAGQDTAPGTKLTVMLGGHWWDDWLPSDLPDEES
AIAMAKSVLARHLRIAEEPTVAKARLQQDAIPQPTVGYVLRMERLHEAMESQFGSRLKVA
GAWYTGVGVNDSICAGRIVAGATLAGQEGVTGLERYLPQNFKGRFVEEG
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagcgatgcttattctgttgcaccctagacgaactatgggcgcatgctcgcccc
agattacacccatgggcccgatctaaacggtggttcacaactcggcgtcctgcatccttt
cgccgattctcctccgctccggccaccaaccagaaaaacatcgcggtcatcggtgctggt
gtaacgggtctgtcaactgcatatcgtctttcccaagacaaaaatgcacgggttaccgtc
tacgaaaagtcacacagactcgggggttggttgcaatcagaaataatcgatgttgatggc
agggatgtcctgttcgaatatggcccccgaactctccgtgcgggatatcggggaagctta
tcaactttggagttgttattcgacctgggtctcaaaaatgatattttagcaacgaagaac
gactcccccgctgcctgcaatcgatacatttactatccagaccacctagtccgccttccg
gggccatatcctggttatggctctctagcgaatatcttgatgaatgtgatacaactatgt
acagagccagtgctctggaaacttgcggtagaagtgatccgcgacccaagcagacaggaa
cgtgaccgttctataacggacgaatccatcggagatttcatgaagcggtgttttggccct
aatgtggcagacgttgttggctccgctttttttcacggcatctatgctggcgatctgtac
aggctaagcgcgcgtacgattttacgcattgcctgggacgaatttcagctatctgaacgg
ggatttgcaacagagcttatggaatatatcaataaaaaacggtttaccatgccttacgat
attttcaaggcgcgccagcttgtttctaaggagaaaataacagatatctgtaattttgcc
gcgggtaataacgtttttactctccgtagagggttggggcaacttgcaacttcactggaa
tcgtcattaaggagtgcaccaaatgtggagatccagactggatcccagattaaatatatc
tctaagggagtagacccatcaccaatgactctcgccctagcagacggcaccacctccaat
ttcgacttcataatctccaccaccccatccacagaactctccaaccaactcctcaactcc
ccaactcaccccccgccaaccgccgtaacaaacatcctcaaccaaaacgactacgccgta
gccgtcatggtcgttaacctctactacaaaaaccccaacctatttccccatcgcggcttc
ggctacttaatcccccgttccatccctttcgacctaaaccccgaacgcgccctgggcgtc
atcttcgcctcagacagcagcgcaggtcaggatacggcaccaggcaccaagctcaccgtc
atgctcggcgggcactggtgggatgactggcttcccagcgacttacccgatgaagagagc
gccatagccatggccaagtcagtgctggcgcgccatttgcgcatcgccgaagaaccaact
gttgccaaggcgcgcttgcagcaggatgcgattccgcagcctacggttgggtatgtgttg
aggatggagaggttgcatgaggctatggagagccagtttgggtcgcggttgaaggttgct
ggggcgtggtatacgggcgttggtgttaatgattcgatatgtgctgggaggattgtggcg
ggggcgacgcttgcggggcaagaaggggttaccgggttggagcgatatctgccgcagaat
tttaaggggaggtttgtggaagagggttag

DBGET integrated database retrieval system