KEGG   Paracoccidioides brasiliensis: PAAG_01136Help
Entry
PAAG_01136        CDS       T02230                                 

Definition
beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PAAG_01136
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    PAAG_01136
   00603 Glycosphingolipid biosynthesis - globo series
    PAAG_01136
   00604 Glycosphingolipid biosynthesis - ganglio series
    PAAG_01136
   00511 Other glycan degradation
    PAAG_01136
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PAAG_01136
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 603 aa AA seqDB search
MLLSEVTLLSLVSLCLALWPLPQEFNHGNTTVWLASSVEFSFQPTVADGGAEKKNIISTY
IDLEEIFDFFQTSWLMKNKTREKLIPSVSKIVKKAIKRTGAEIFSSKFVPWKFHPRNSSF
EPALDGRDAVIRQVIIKQASTYQSEAKIRDFVHEEESYKIEISATGEATISTKTAIGTIR
ALQTFRQLFYVHSSGPGVYTPFAPISISDAPKWAHRGINIDISRNAYTSADIKRTIDAMA
SAKMNRLHIHATDSQSWPLDIPALPSLAAKGAYHADLIWTSSNLSDVQMYGLERGVSVFL
EIDMPGHTGSIGYAFPELVSAFLADKWQEYALQPPSGQIKLNSSGVNEFLDKLMADILPR
VSPFTGYFHTGGDEFNLNTYLLEETVRSNNRDVLKPLLQAVVTRLHDAIRKAGLTPIVWE
ELVTDWELSLSTSSTEKTDVIVQAWRNSSAVKLLLDRGYRTIFGSGDAWYLDCGHGTYIN
PKRGSVSVKDPFVDWCSPYKNWKHMYIYNPLEGIPGKLHHLVEGGEAHMWSENVDPVILD
SLIWPRAAAAAEVLWSGPRTADQIHDASFRLSEWRERAVIDVGVRASLAQLTYCLMREGS
CEL
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgctgctctctgaggtcactttgctcagtttagtctcgttgtgtctggctttatggcct
ctgccgcaggagttcaaccatggcaacacaactgtttggctggcctcgtctgtggaattc
tccttccagcctactgttgcagacggcggtgctgagaaaaaaaatattatctctacgtac
atagatttggaggaaatcttcgatttcttccaaacatcctggttgatgaagaacaagact
agagagaaactcattccgagtgtttccaaaatagtgaaaaaggctataaagcggacggga
gcagagatatttagctccaaattcgttccctggaaattccatccgcgaaatagctctttt
gaacctgcgttggacgggcgtgatgcagttatccgccaagtaatcatcaagcaagcctct
acgtatcaatcggaagcgaagattcgcgatttcgtccacgaagaagagagctacaagatt
gaaatttccgctaccggggaagcaacaatttcgaccaagacagctatcgggactatccgt
gcacttcaaacctttagacagctcttctatgtacattcttccggacccggtgtgtataca
ccctttgcaccaatttcaatatcggacgccccgaaatgggcgcatcgcggcatcaacatt
gatatatccagaaatgcatacacgtcagcggatatcaaacgaaccattgacgccatggct
tctgccaaaatgaaccgccttcatatccatgcaacagactctcagtcatggccattggat
atccccgcactaccctcgttggcagcgaaaggagcgtatcatgcagacctgatctggaca
tcttctaacctctcagatgtccagatgtatggcttggaacgtggggtgtccgtatttctt
gagatagatatgccaggccacacaggatcaatcggatatgccttcccggagctagtttcc
gcatttctagctgataagtggcaagagtatgcactccaacctcccagtgggcaaatcaag
ttgaattcttctggcgtgaatgaatttttggataagttgatggcggatatacttcctcgc
gtctcgccatttactggctactttcatacaggcggcgacgagttcaaccttaatacgtac
ctcctcgaagaaacagtccgatcgaacaacagagacgtcctaaaacctttgcttcaagct
gttgtgacacgtctccacgacgcgatacgtaaagctggcctcacacccatagtatgggag
gaactcgtaactgactgggaactatcgctatctacctcctctaccgaaaaaaccgacgtt
attgtgcaagcgtggcgaaactcctccgccgtcaagctgttactggatcgtgggtaccgc
acgattttcggctcgggcgacgcctggtacctcgactgcggacatggcacctacataaat
cctaaacgcggctctgtctcagtaaaagatccattcgtcgactggtgcagcccatataaa
aactggaaacacatgtacatctataaccctcttgaaggtattccggggaaactgcaccac
ctggttgaagggggcgaggcacatatgtggtcagagaatgttgacccggtaatccttgac
agtttgatctggccacgtgcggctgcagccgcggaggttctttggagcggtccacgaacc
gctgatcagatacatgatgcttcattccgacttagcgaatggcgtgagcgtgctgtgatt
gatgtgggcgtcagggctagcctagcccaattaacgtattgtctcatgagggaagggagc
tgcgagctgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system