KEGG   Paracoccidioides brasiliensis: PAAG_01136Help
Entry
PAAG_01136        CDS       T02230                                 

Definition
beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pbl00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:pbl00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:pbl00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:pbl00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 603 aa AA seqDB search
MLLSEVTLLSLVSLCLALWPLPQEFNHGNTTVWLASSVEFSFQPTVADGGAEKKNIISTY
IDLEEIFDFFQTSWLMKNKTREKLIPSVSKIVKKAIKRTGAEIFSSKFVPWKFHPRNSSF
EPALDGRDAVIRQVIIKQASTYQSEAKIRDFVHEEESYKIEISATGEATISTKTAIGTIR
ALQTFRQLFYVHSSGPGVYTPFAPISISDAPKWAHRGINIDISRNAYTSADIKRTIDAMA
SAKMNRLHIHATDSQSWPLDIPALPSLAAKGAYHADLIWTSSNLSDVQMYGLERGVSVFL
EIDMPGHTGSIGYAFPELVSAFLADKWQEYALQPPSGQIKLNSSGVNEFLDKLMADILPR
VSPFTGYFHTGGDEFNLNTYLLEETVRSNNRDVLKPLLQAVVTRLHDAIRKAGLTPIVWE
ELVTDWELSLSTSSTEKTDVIVQAWRNSSAVKLLLDRGYRTIFGSGDAWYLDCGHGTYIN
PKRGSVSVKDPFVDWCSPYKNWKHMYIYNPLEGIPGKLHHLVEGGEAHMWSENVDPVILD
SLIWPRAAAAAEVLWSGPRTADQIHDASFRLSEWRERAVIDVGVRASLAQLTYCLMREGS
CEL
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgctgctctctgaggtcactttgctcagtttagtctcgttgtgtctggctttatggcct
ctgccgcaggagttcaaccatggcaacacaactgtttggctggcctcgtctgtggaattc
tccttccagcctactgttgcagacggcggtgctgagaaaaaaaatattatctctacgtac
atagatttggaggaaatcttcgatttcttccaaacatcctggttgatgaagaacaagact
agagagaaactcattccgagtgtttccaaaatagtgaaaaaggctataaagcggacggga
gcagagatatttagctccaaattcgttccctggaaattccatccgcgaaatagctctttt
gaacctgcgttggacgggcgtgatgcagttatccgccaagtaatcatcaagcaagcctct
acgtatcaatcggaagcgaagattcgcgatttcgtccacgaagaagagagctacaagatt
gaaatttccgctaccggggaagcaacaatttcgaccaagacagctatcgggactatccgt
gcacttcaaacctttagacagctcttctatgtacattcttccggacccggtgtgtataca
ccctttgcaccaatttcaatatcggacgccccgaaatgggcgcatcgcggcatcaacatt
gatatatccagaaatgcatacacgtcagcggatatcaaacgaaccattgacgccatggct
tctgccaaaatgaaccgccttcatatccatgcaacagactctcagtcatggccattggat
atccccgcactaccctcgttggcagcgaaaggagcgtatcatgcagacctgatctggaca
tcttctaacctctcagatgtccagatgtatggcttggaacgtggggtgtccgtatttctt
gagatagatatgccaggccacacaggatcaatcggatatgccttcccggagctagtttcc
gcatttctagctgataagtggcaagagtatgcactccaacctcccagtgggcaaatcaag
ttgaattcttctggcgtgaatgaatttttggataagttgatggcggatatacttcctcgc
gtctcgccatttactggctactttcatacaggcggcgacgagttcaaccttaatacgtac
ctcctcgaagaaacagtccgatcgaacaacagagacgtcctaaaacctttgcttcaagct
gttgtgacacgtctccacgacgcgatacgtaaagctggcctcacacccatagtatgggag
gaactcgtaactgactgggaactatcgctatctacctcctctaccgaaaaaaccgacgtt
attgtgcaagcgtggcgaaactcctccgccgtcaagctgttactggatcgtgggtaccgc
acgattttcggctcgggcgacgcctggtacctcgactgcggacatggcacctacataaat
cctaaacgcggctctgtctcagtaaaagatccattcgtcgactggtgcagcccatataaa
aactggaaacacatgtacatctataaccctcttgaaggtattccggggaaactgcaccac
ctggttgaagggggcgaggcacatatgtggtcagagaatgttgacccggtaatccttgac
agtttgatctggccacgtgcggctgcagccgcggaggttctttggagcggtccacgaacc
gctgatcagatacatgatgcttcattccgacttagcgaatggcgtgagcgtgctgtgatt
gatgtgggcgtcagggctagcctagcccaattaacgtattgtctcatgagggaagggagc
tgcgagctgtag

DBGET integrated database retrieval system