KEGG   Paracoccidioides brasiliensis: PAAG_01324Help
Entry
PAAG_01324        CDS       T02230                                 

Definition
folic acid synthesis protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PAAG_01324
Enzymes [BR:pbl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PAAG_01324
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PAAG_01324
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 600 aa AA seqDB search
MRNSSAAARKVSAALRPHKGALPADGDLTSLSLLLRGGSGSASVPGRHLNGSSTWEGTSS
PKRSFSQCSPAPGRGLRVLQINAAGGQQPCQFTGLLSGNLRVRNSASHVMNQQRAYSSSP
APAAGSSSAGEAQSPCRAFIALGSNMGDCIAMIEQACREMEARGLKIIRTSSLFETAPMY
VTDQGKFVNGACEIETTMGPIALLNTLQSIENDMGRRKIIDKGPRNIDLDILLYNDLKFS
HPRLEIPHKLMLEREFVLRPLCQLIPNERPPLSDKALSYQSYLDSLPPSNPPPIAVTPLF
PHLPPLTPSDPKRATNIMAVLNVTPDSFADGGKHSPENIPALTETILNFIKHGATIIDVG
GESTRPGCPPVTKEVELSRVIPTIRLIRSLPEANKIAVSIDTYRASVAEAAVEAGADIIN
DISGGTMDPNMLATMAKLQKTVILQHMRGTPQTMTKLTDYSAYADGPGGGSGIISGVANE
LIKRVREAEKVGVRRWRIILDPGIGFAKIQPQNLEILRNGLILRGAFEELNYFPWLVGTS
LKGFIGNITGVQTPSERLWGTAAGVTASIAGGADIVRVHNVNEMRQVVKMADAIYRDRVD
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaattcctcagcggccgccagaaaagtatccgcagcattgcgtccacacaaaggc
gcactccctgccgacggtgatttgacctcactgtcacttttgttgcggggcggcagcggt
tctgcttctgtcccaggtcgccaccttaacggatcctctacatgggaaggcacatctagc
cccaaacgctcgttctctcagtgcagccctgcgccaggacgtggcctccgtgttctgcag
ataaatgcagccggggggcaacaaccgtgccagttcacagggcttctctctggtaatctc
cgtgtcaggaactctgcttcacacgtcatgaatcagcagcgggcttattccagctctcca
gcaccagcagctggttcatccagtgctggggaggctcagtcgccatgccgggcattcatt
gccctgggcagcaatatgggtgactgtattgccatgatcgagcaagcatgccgagaaatg
gaagcccgtggtctcaaaatcatacgaactagcagtctcttcgaaacagcgcctatgtat
gtgacggatcagggaaaattcgtcaatggcgcctgtgagattgaaactacgatggggcct
attgcgttattaaacaccctccagtcaattgagaacgatatgggaagacgtaaaattata
gacaagggtccccgtaatatcgatcttgatatactgctgtacaatgatttaaaattctca
caccctcgactggaaataccccacaaattaatgctggaacgggaatttgtcttgcgaccg
ctttgccaacttatacccaatgaacgccctcccctatctgataaagccctctcatatcag
tcatacctagactcgcttcctccctccaatccccccccaatcgccgttacccctttattt
ccccatctcccacccctcacccccagcgaccccaaacgcgccaccaacatcatggctgtc
ctaaacgtgactccagactccttcgccgatggcggcaagcactcacccgaaaacatcccc
gcactgactgagaccatcctcaactttattaagcacggagcgaccatcatcgacgtagga
ggcgaaagtacccgccctggctgccctcccgtgaccaaagaagtggagctttcgcgcgtc
atccctaccatacggcttatccgctccctccccgaggccaacaaaatcgcagtcagcatc
gatacatatcgcgctagtgtcgcggaggcggctgttgaggcaggagcagatatcataaac
gatatctctgggggcactatggatcccaacatgctggctaccatggctaaacttcagaag
acagtgatcctccagcacatgcgcggcacgccgcagacaatgaccaaacttaccgattac
agcgcatatgccgatggccctgggggcggaagcggcatcatcagtggtgtcgctaatgaa
ctcataaagagagtcagagaggcggagaaagttggtgtgcggcgctggagaataattctc
gaccccggaattggctttgcgaagatccaaccccagaatctcgagattttgaggaacggg
cttattttgaggggagcatttgaagagttgaattacttcccgtggctggtgggaacgagt
ttaaaaggctttattgggaatattacaggggttcagacgcctagtgaacggctctggggt
acagcggcaggtgttacggcttctatagctggtggtgcggatatcgtaagggtgcacaat
gtgaacgagatgaggcaggtggttaaaatggcagatgcaatttatagagatagagtcgat
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system