KEGG   Paracoccidioides brasiliensis: PAAG_01372Help
Entry
PAAG_01372        CDS       T02230                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PAAG_01372
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    PAAG_01372
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PAAG_01372
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 915 aa AA seqDB search
MGFDGTSVNSEIRSLIEDYHLGSVILTAKNLKSAEETTKLVYELQSIARNAGHPVPLMIC
LDQENGGVNSLFDEIYIRQFPSAMGMAATGSKSLAREVSKATAQELSAVGINWILGPVLD
ALTNARNQPLGVRSVGDDPQEVSAYGIEFMKGYQDAGLVTCGKHFPSYGNLDYMGSQSDV
PIITDSIEQLSVSALVPYRSAITNGIDSMMVGGCAMSSAGMTVMHACLSEQVVDDLLRKD
LKFDGVVVSECLEMEALSYNIGVRGGTVMAMKAGCDIILLCRSFSIQQEAINGLKVGVEN
GMISKSRIRESLRRVLDMKSRCTSWEKALNPQGISLLSRMQPSHTSLSTKAYNSSLTVVR
DKHNYLPLTSILEPDEELLLLTPLVKPLPASATLLSIVTENSNRPSLSTDAVSWERNASV
MSGESVFREFGRSLARQRNGRVLHTSYTANGVRPVHENLIDRASAVIIVTADANRNLYQN
GFTKHVSLICNSQFSPSGERRAKPVVVVAVSSPYDFATDQSIGTYICTYDFTETALQTLV
KILYGELVPTGSLPGSLSRNQRLQQSRQHWLVENWNEDRDTHALDSLLNIVREDVTQGQR
SELFSVTSSTLLLRNNDVEESHFVVRNSSTHSLYGFCSTYYFKSTGTGVIGALIVDPSRR
RMSIGHSLHNRAIRTLIQRPGIRSFQLGARLPGIYLGIPTGNPVERKRLRQWFANLGWNT
ALSRSVCSMVLRNLENWTPPEGLTKILQSSDVDYDLVYGWEYADSVLDHVKTTSRVGVME
LYKRGLSGAPGSGIIRAKRREDGTILGSVVVYNSTSTLAEAMPALRETHAISGAISSPVI
SPSVGEYATLVQGLILLGIKQIRKQGASAAVLDCVDGDGNYDSLSSMGFSVLHSFDEVTC
DVSNWNMITDAIILP
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcgatggtactagtgttaattctgagatccgttcgctaatcgaggactatcat
ctcggttccgtcatattgaccgctaagaatttgaaatcggcagaagaaacgaccaagctg
gtgtacgagctacaatccatcgcgcggaatgctggccatcctgtgccacttatgatatgt
ctcgaccaagaaaatggcggtgtcaatagtctcttcgatgaaatttacattcgccagttc
cccagcgccatggggatggctgcgactggttcgaaatctctcgccagagaagtttctaag
gctactgctcaggaacttagcgcagttggtataaattggatcctgggtcccgtgctagat
gcgttgacgaatgccagaaaccagcctctgggtgttcgaagtgtaggcgatgacccccag
gaggtatctgcctatggcatcgagtttatgaaaggctatcaagatgcgggcttggtaact
tgcggaaagcattttccctcgtatggcaatttagattatatgggctcccaatccgatgtt
cccattatcacggattcgattgagcaactcagcgtgagcgcgctagtgccatacaggagc
gcaatcacaaatggtatagactccatgatggtaggaggatgtgcaatgtcgtctgctggg
atgaccgtcatgcatgcctgtttgtccgaacaggttgtggacgacctcctgcgaaaagac
ctgaaattcgacggcgtggtcgtttcagaatgcctagaaatggaggcgctcagttacaac
ataggggttcgcggtggaacagtcatggccatgaaggcgggctgtgacatcatcctgtta
tgtcgttctttctctattcaacaggaagctatcaatgggctaaaggtaggggtagagaat
ggtatgattagtaaaagccggatacgcgaatcattgcgaagggtcctggatatgaagtcg
cgatgcacgtcatgggaaaaagcattgaatccccaaggaatcagccttctttcaagaatg
caaccgtcacatacaagtctatccaccaaagcatataacagttccctcaccgttgtcaga
gataaacacaattaccttccgttaacgagtatcctggaacccgacgaagaacttcttctc
ctcacacctttggttaagccactccctgcgtctgccacgttgttatcgattgttaccgaa
aactcaaatcgaccatcactctcaactgatgccgtctcatgggaacgcaatgcttccgtg
atgagcggcgagagcgttttcagagagtttgggcggtcgttagctcgacagaggaacggg
cgagttttgcatacctcctacacggccaacggtgtccggcctgtccatgaaaatttaatc
gatcgtgcaagcgcagtcattatcgtcactgctgatgcaaatagaaacctttaccaaaac
ggttttaccaagcatgtgtcccttatctgcaactcccaattttctcccagtggagaacgt
cgcgcaaaacctgtggttgttgtagctgtcagctcgccttatgattttgctacagatcag
tctataggtacctatatttgcacttacgacttcacagaaaccgcccttcaaactctagtc
aagattctatatggagagctggtacccacgggctcacttcccggctctctcagccgtaac
cagagactgcaacaatcaaggcaacactggttggtggagaattggaacgaagaccgggat
acccacgctctcgatagtctcctcaatattgttagagaagatgttactcaaggccaacgg
tctgaactttttagcgtaacctcctccactcttcttctacgcaacaacgacgtggaagag
tctcacttcgtagtaagaaacagtagcactcattcgctctatggattctgctcgacatat
tacttcaaatccaccggaaccggtgtgatcggcgcgcttattgtcgacccttcccgccga
agaatgtccattggccattcacttcataaccgtgcaatccgaacactgatccaacgtccg
ggcatccgaagcttccagctcggcgccagattacccgggatatatctgggaatccccaca
ggcaacccagtggaacgcaagaggcttaggcagtggttcgccaatctggggtggaacaca
gccctctctcgctcagtttgcagcatggtcctgcgaaatctcgaaaactggacgccacca
gaggggctaacgaaaatcctacagagctctgatgtggattatgatcttgtttatggctgg
gagtatgcagactcggttctggatcatgtcaagactacatcgcgcgtgggggttatggag
ctttacaagagggggctaagcggtgcgcctggaagtggtattattcgggctaaacgccgt
gaagacggaacgatactgggtagtgtggtagtatataattctacttcgacgctggcggag
gcaatgcccgcccttagggaaactcacgcgatatccggggcgatctcttcgccggtgata
tccccttcagtgggggaatatgctacgctggtgcagggattaatattactggggatcaag
cagatacgaaagcaaggggctagtgcagcagttcttgattgcgttgacggcgacggaaat
tatgatagtctctcctccatgggattttctgtgctgcacagcttcgatgaagtcacctgc
gacgtttctaactggaatatgatcacggacgccataattcttccctga

DBGET integrated database retrieval system