KEGG   Paracoccidioides lutzii Pb01: PAAG_01372Help
Entry
PAAG_01372        CDS       T02230                                 

Definition
(RefSeq) beta-hexosaminidase
  KO
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PAAG_01372
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    PAAG_01372
 Human Diseases
  Antimicrobial resistance
   01501 beta-Lactam resistance
    PAAG_01372
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PAAG_01372
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 925 aa AA seqDB search
MREFDYRQMGQLFVMGFDGTSVNSEIRSLIEDYHLGSVILTAKNLKSAEETTKLVYELQS
IARNAGHPVPLMICLDQENGGVNSLFDEIYIRQFPSAMGMAATGSKSLAREVSKATAQEL
SAVGINWILGPVLDALTNARNQPLGVRSVGDDPQEVSAYGIEFMKGYQDAGLVTCGKHFP
SYGNLDYMGSQSDVPIITDSIEQLSVSALVPYRSAITNGIDSMMVGGCAMSSAGMTVMHA
CLSEQVVDDLLRKDLKFDGVVVSECLEMEALSYNIGVRGGTVMAMKAGCDIILLCRSFSI
QQEAINGLKVGVENGMISKSRIRESLRRVLDMKSRCTSWEKALNPQGISLLSRMQPSHTS
LSTKAYNSSLTVVRDKHNYLPLTSILEPDEELLLLTPLVKPLPASATLLSIVTENSNRPS
LSTDAVSWERNASVMSGESVFREFGRSLARQRNGRVLHTSYTANGVRPVHENLIDRASAV
IIVTADANRNLYQNGFTKHVSLICNSQFSPSGERRAKPVVVVAVSSPYDFATDQSIGTYI
CTYDFTETALQTLVKILYGELVPTGSLPGSLSRNQRLQQSRQHWLVENWNEDRDTHALDS
LLNIVREDVTQGQRSELFSVTSSTLLLRNNDVEESHFVVRNSSTHSLYGFCSTYYFKSTG
TGVIGALIVDPSRRRMSIGHSLHNRAIRTLIQRPGIRSFQLGARLPGIYLGIPTGNPVER
KRLRQWFANLGWNTALSRSVCSMVLRNLENWTPPEGLTKILQSSDVDYDLVYGWEYADSV
LDHVKTTSRVGVMELYKRGLSGAPGSGIIRAKRREDGTILGSVVVYNSTSTLAEAMPALR
ETHAISGAISSPVISPSVGEYATLVQGLILLGIKQIRKQGASAAVLDCVDGDGNYDSLSS
MGFSVLHSFDEVTCDVSNWNMMSAS
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgagttcgactacaggcagatggggcagctctttgtcatgggcttcgatggtact
agtgttaattctgagatccgttcgctaatcgaggactatcatctcggttccgtcatattg
accgctaagaatttgaaatcggcagaagaaacgaccaagctggtgtacgagctacaatcc
atcgcgcggaatgctggccatcctgtgccacttatgatatgtctcgaccaagaaaatggc
ggtgtcaatagtctcttcgatgaaatttacattcgccagttccccagcgccatggggatg
gctgcgactggttcgaaatctctcgccagagaagtttctaaggctactgctcaggaactt
agcgcagttggtataaattggatcctgggtcccgtgctagatgcgttgacgaatgccaga
aaccagcctctgggtgttcgaagtgtaggcgatgacccccaggaggtatctgcctatggc
atcgagtttatgaaaggctatcaagatgcgggcttggtaacttgcggaaagcattttccc
tcgtatggcaatttagattatatgggctcccaatccgatgttcccattatcacggattcg
attgagcaactcagcgtgagcgcgctagtgccatacaggagcgcaatcacaaatggtata
gactccatgatggtaggaggatgtgcaatgtcgtctgctgggatgaccgtcatgcatgcc
tgtttgtccgaacaggttgtggacgacctcctgcgaaaagacctgaaattcgacggcgtg
gtcgtttcagaatgcctagaaatggaggcgctcagttacaacataggggttcgcggtgga
acagtcatggccatgaaggcgggctgtgacatcatcctgttatgtcgttctttctctatt
caacaggaagctatcaatgggctaaaggtaggggtagagaatggtatgattagtaaaagc
cggatacgcgaatcattgcgaagggtcctggatatgaagtcgcgatgcacgtcatgggaa
aaagcattgaatccccaaggaatcagccttctttcaagaatgcaaccgtcacatacaagt
ctatccaccaaagcatataacagttccctcaccgttgtcagagataaacacaattacctt
ccgttaacgagtatcctggaacccgacgaagaacttcttctcctcacacctttggttaag
ccactccctgcgtctgccacgttgttatcgattgttaccgaaaactcaaatcgaccatca
ctctcaactgatgccgtctcatgggaacgcaatgcttccgtgatgagcggcgagagcgtt
ttcagagagtttgggcggtcgttagctcgacagaggaacgggcgagttttgcatacctcc
tacacggccaacggtgtccggcctgtccatgaaaatttaatcgatcgtgcaagcgcagtc
attatcgtcactgctgatgcaaatagaaacctttaccaaaacggttttaccaagcatgtg
tcccttatctgcaactcccaattttctcccagtggagaacgtcgcgcaaaacctgtggtt
gttgtagctgtcagctcgccttatgattttgctacagatcagtctataggtacctatatt
tgcacttacgacttcacagaaaccgcccttcaaactctagtcaagattctatatggagag
ctggtacccacgggctcacttcccggctctctcagccgtaaccagagactgcaacaatca
aggcaacactggttggtggagaattggaacgaagaccgggatacccacgctctcgatagt
ctcctcaatattgttagagaagatgttactcaaggccaacggtctgaactttttagcgta
acctcctccactcttcttctacgcaacaacgacgtggaagagtctcacttcgtagtaaga
aacagtagcactcattcgctctatggattctgctcgacatattacttcaaatccaccgga
accggtgtgatcggcgcgcttattgtcgacccttcccgccgaagaatgtccattggccat
tcacttcataaccgtgcaatccgaacactgatccaacgtccgggcatccgaagcttccag
ctcggcgccagattacccgggatatatctgggaatccccacaggcaacccagtggaacgc
aagaggcttaggcagtggttcgccaatctggggtggaacacagccctctctcgctcagtt
tgcagcatggtcctgcgaaatctcgaaaactggacgccaccagaggggctaacgaaaatc
ctacagagctctgatgtggattatgatcttgtttatggctgggagtatgcagactcggtt
ctggatcatgtcaagactacatcgcgcgtgggggttatggagctttacaagagggggcta
agcggtgcgcctggaagtggtattattcgggctaaacgccgtgaagacggaacgatactg
ggtagtgtggtagtatataattctacttcgacgctggcggaggcaatgcccgcccttagg
gaaactcacgcgatatccggggcgatctcttcgccggtgatatccccttcagtgggggaa
tatgctacgctggtgcagggattaatattactggggatcaagcagatacgaaagcaaggg
gctagtgcagcagttcttgattgcgttgacggcgacggaaattatgatagtctctcctcc
atgggattttctgtgctgcacagcttcgatgaagtcacctgcgacgtttctaactggaat
atgatgtccgcttcatga

DBGET integrated database retrieval system