KEGG   Paracoccidioides lutzii Pb01: PAAG_01410Help
Entry
PAAG_01410        CDS       T02230                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase tor2
  KO
K07203  
serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
Regulation of mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Cellular Processes
  Transport and catabolism
   04139 Regulation of mitophagy - yeast
    PAAG_01410
Enzymes [BR:pbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     PAAG_01410
Protein kinases [BR:pbl01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   PAAG_01410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 2374 aa AA seqDB search
MAQVPSGTDATQRIFHDLKSKHEETRSRASFELHENVAAASRELPPDKFIEYYNAVSQRI
AQFVVTGNDVNEKIGGLLALDRLIDFDGVDAAQKTTRFASYLRSALRSNDSTVLVYAARS
LGRLAKPGGALTAELVESEIQSAMEWLQSERQENRRFAAVLVIRELAKGSPTLLYGFVPQ
IFELIWVALRDQKVLIRETSAQAVSECFEILAARDFQVRQQWFGRIYEECLLGLRSSNVD
WIHGSLLTLRELLLKGAMFMNEHYRNACEIVLRLKDHREPKIRIQIVLTIPILASYAPLE
FTNIYLHRFMIYLQAQLKREKERNAAFIAIGKIANAVGNSIAQFLDGIIVYIREGLTMKA
RNRAAVDEGPMFECISMLSLAVGQTLSKYMEALLDPIFACGLSESLTQALVDMAHYIPPI
KATIQEKLLDMLSIVLCGTPFRPLGCPENRPPPMPSFAKDYGPFLQEPTDSEIALALHTL
GSFDFSGHILNEFVRDVAITFVNNDNPEIRKASALTCCQLFVSDPILNQKSSHSIQVVGE
VVDTLLTVGVGDPDPDIRRIVLESLDKKFDSHLAKPESVRCLFLAVNDEVFPVREAAISI
IGRLSGVNPAYVFPPLRKLLVNLLTGLSFATTSRQKEESAQLISLFVANATKLVRSYVDP
MVTALFPKTTDPNPGVAATTLKAIGELATVGGEDMRQYLPQLMPIILDALQDLSCQSKRE
AALRTLGQLASNAGYVIEPYLEYPHLLAVLINIVKTEQTGSLRKETIKLLGIIGALDPYK
HQQISESVPDIHHINEVQRVSDVSLIMQGLTPSNEEYYPTIVINTLLQNILNESSLAQYH
SAVIDAIVTIFKTLGLKCVPFLGQIIPAFVLVIRSTPTSRLESYFNQLAILVTIVRQHIR
AFLPEIIEVIREFWDSSYQVQATILSLIEAIAKSLEGEFKKYLAGLIPLMLDTLDKDITP
RRQPSERILHTFLIFGSSGEEYMHLIAPAIVRLFDKSQSPSGIRKSAIETLGKLSRQVNV
SDFSSLMIHPLSRVIAGTDRTLRQAALDCVCTLIFQLGQDFNNYIQLINKTISAHQISHH
NYQILVSKLQKGDPLPQDLNPDEHYSTLGDDSTFADVGQKKILVNQQHLKNAWDASQKST
REDWQEWIRRFSVELLKESPSHALRACASLAGIYQPLAKDLFNAAFVSCWTELYDQYQEE
LVRSIDMALTSQNIPPEILQILLNLAEFMEHDDKALHIDIRTLGKYAGKCHAFAKALHYK
ELEFEQDQNSGAVEALISINNQLQQSDAAIGILRKAQAYRDVELKETWFVKLQRWEEALA
AYKRRELIDPDSFDVTMGKMRCLHALGEWKMLSDLAQEKWNHASNEHRKAMAPLAAGAAW
GRGQWELMDSYISVMKEQTPDRSFFGAILAIHNRKFDEAAMFIEKARNGLDTELSALLGE
SYNRAYNVVVRVQMLAELEEIIIYKQNDDDPEKQEAMKETWNKRLLGCQQNVEVWQRMLK
VRALVISPRENLDMWIKFANLCRKSNRMGLADRSLSSLEGGELGTPPEVAYARLKYEWAA
GRQKEALQMLRDFTIGLTEEFARYNAALVAHSEHAPADRPGLVNGISDHPELALTRQHIG
DVGKFRRLLAKSHLKQGEWQTALQRGDWTSEGVRDVLNSYSAATQYNRDSYKAWHAWALA
NFEVVNALSTQTNRETVVPHHIVLEHVIPAIRGFFRSIALSSTSSLQDTLRLLTLWFTHG
GDAEVSGVVSEGFSSVIVDTWLEVTPQLIARINQPNARVRGAVHRLLAEVGKAHPQALVY
PLTVATMSNVVRRSQSASHIMDSMRQHSPRLVEQAEIVSHELIRVAVLWHELWHEGLEEA
SRLYFGDHNVEGMFATLAPLHDMLDKGAETLREVSFAQAFGRDLAEAKHFCLLYRDSGVI
GDLNQAWDLYYTVFRKIARQLPQLQSLDLKYVSPKLKDAVDLELAVPGTYQSGKPVIRIM
SFDPVSIVLQTKKRPRKMTLKGSDGNSYMYALKGHEDIRQDERVMQLFGLVNTLLDHDSE
SFKRHLTIQRFPAIPLSQNSGLIGWVSNTDTLHALIKEYRESRRILLNIEHRIMLQMAPD
YDNLTLMQKVEVFGYAMDNTTGKDLYRVLWLKSKSSESWLERRTNYTRSLGVMSMVGYIL
GLGDRHPSNLLLERITGKIVHIDFGDCFEIAMHREKYPERVPFRLTRMLTFAMEVSNIEG
SYHITCEAVMRVIRENKESLMAVLEAFIHDPLINWRLGARESPARPSFAADRRQSVVEEI
NMDHPVQPSNFSRRRPSILEGGILDAQQGVPNEAREVQNARALQVLSRVKEKLTGRDFKS
TEELNVSDQVDKLLVQATSVENLCQHYIGWCSFW
NT seq 7125 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggtaccttcgggaacagacgcaacccagcggattttccatgaccttaagtcc
aagcatgaagaaacacgctcccgtgcttccttcgagctccatgagaatgttgccgctgcc
tctagagagctaccaccggacaagttcatcgaatactacaatgcggtatcccagcgtatc
gctcaatttgttgttactggcaatgacgtaaacgagaagatcggtggcctcctggccctc
gacaggttgatagattttgatggcgtagatgctgctcaaaaaacgacacgatttgcaagc
tatctgcggagtgcacttcgcagcaacgacagcaccgtcctagtctatgctgcgcgttca
cttggccgtctggcaaaacccggcggtgcattgacggcagaattggtagaaagcgaaata
caatctgctatggaatggctgcagtcagaaaggcaggaaaacaggcgttttgctgctgtt
ctagtgatccgggaacttgcgaagggatcccccactttgctctacggctttgtgccgcag
atattcgagcttatctgggtggcactgcgtgaccaaaaggttctgattagagagacatct
gctcaggccgttagcgaatgcttcgaaattctggctgcaagagatttccaagtccgtcag
cagtggtttggtcggatatatgaagaatgtttgctaggactgagatcaagcaatgtagat
tggattcacggctcgcttctgaccttgagggagctcctgttgaagggcgctatgttcatg
aacgagcattaccgaaatgcctgtgaaattgtccttcgcctcaaggatcaccgtgagccg
aagattcgaatacaaattgtccttaccatcccgattctcgcatcttatgcacctctagaa
ttcaccaacatatatttacacagatttatgatatatctacaggcacagctaaagagggag
aaggagagaaatgctgccttcattgccatcggaaaaatcgcgaatgccgttggaaattct
attgcacagtttcttgatgggattattgtctatatccgggaaggactgacaatgaaagct
cgtaaccgtgctgcggtcgatgaaggtccgatgtttgagtgcataagcatgctgtcttta
gctgttggacaaaccctcagcaaatacatggaagccttattggatccaatctttgcatgc
ggtctgagcgaatctctcacacaggctttggtagatatggcgcattatatccctcccatt
aaggcaacgattcaagaaaaactgcttgatatgttaagcatagtcctatgtggaacccca
tttaggccccttgggtgccctgaaaaccgccctcccccaatgccctcctttgcaaaagat
tatggacctttcctgcaagaaccaactgatagcgaaattgctcttgcattacatacgctc
ggcagttttgatttctctgggcatattttaaacgaatttgtccgcgacgttgctattaca
tttgtcaataatgacaacccggaaatccgtaaagcgtcagccttaacatgttgtcaacta
ttcgtcagcgacccaattcttaatcaaaagagcagccactccatccaggtagttggtgag
gttgtcgacactctcctcactgttggtgtcggagaccctgatccagatattcgacgaatt
gtcctggagtccttggataagaaatttgacagtcacttggccaaacctgaaagtgttcga
tgccttttcctggccgtgaacgatgaagtatttcccgttcgggaagccgcaattagtatc
atcggccgcctgtccggcgtcaatccagcatacgttttccctccgttaagaaaactgctg
gtgaacctgttgactggacttagctttgctaccacatcccgacaaaaggaagaaagcgcc
cagctaattagcctgttcgttgcgaatgctacgaagcttgttcgatcgtatgttgaccct
atggtgactgctctatttccgaaaacaacagatcccaatccaggagtggcggcgacaact
ttgaaggccatcggagagcttgcaacagttgggggagaggatatgaggcaatatttaccg
caactcatgcccattatcctggatgcacttcaggatctatcgtgccaatccaaaagagaa
gcagcgctacgaaccctggggcagcttgcaagtaacgcaggatatgtcatcgagccctac
cttgaatatccccaccttcttgctgttcttatcaatattgttaaaactgaacaaactggg
tctcttaggaaagagaccataaagctgctaggtattatcggtgctttggatccgtataaa
caccagcaaataagtgaatcggtaccagatatacatcatatcaatgaagtccagcgggta
tcagacgtgtcccttattatgcaaggcctgacgccctctaacgaagagtactatcccacc
attgttatcaacaccctgctccaaaatattctcaacgagagttctctcgcccaatatcac
tcagctgttatcgatgctattgtgacgatattcaagaccctgggattgaagtgtgttccg
ttcttggggcaaattatccctgccttcgtattagttattaggagtactccgactagtcgt
cttgaatcttacttcaaccaactagcaatcctagtgaccatcgtgaggcaacacatccgt
gccttcctgccagaaataatcgaggtcattcgtgaattctgggattcctcttaccaagtc
caagcgacgatattgtcacttatcgaggcaattgcaaagtcactggagggggaattcaag
aaatacttggctggcctgatcccacttatgcttgacacgttagataaggatatcacacca
agacgtcaaccctcagaaagaattttgcacacatttcttatattcggctctagtggagag
gaatacatgcatttgatcgccccggctattgttcgcttatttgataaaagccagagtccc
tccggaattcgaaagtccgccattgaaactctggggaaactctctcgccaggttaacgta
tctgacttctcgtctcttatgatacatccactgtcaagggtgatcgcaggcaccgatcgt
acccttcggcaggcggcgctggattgtgtctgcacgctcatattccaactcggccaggac
ttcaacaactatatccagcttatcaacaaaaccatttcagcccaccaaattagtcatcac
aattatcaaattctagtttcgaaactacagaaaggagatcctttgcctcaggatctgaac
ccggatgagcactatagcacccttggcgatgattctacgttcgctgatgtcggccagaag
aagattctagttaatcagcagcatttgaagaatgcatgggacgcgtctcaaaaatcgaca
cgagaggattggcaagagtggattcgacgattcagtgttgaactacttaaggaatctcca
tctcacgctcttcgggcgtgcgccagtttagccggaatataccagcctcttgcgaaagat
cttttcaatgccgcttttgtctcgtgctggacggaactgtatgaccaataccaggaagag
ctcgttcgttcaatagacatggcccttacctcacagaatattccccccgagatcttacag
atcctcctcaatcttgcagagtttatggaacatgacgacaaggcgcttcatatcgatatt
cgaacccttggaaaatatgctggtaaatgtcacgcatttgctaaagctcttcattataag
gaattggaattcgaacaagaccaaaattccggcgctgtggaagccttaatcagcatcaat
aatcaactccagcaatcagatgctgctattggaatacttcggaaggctcaggcttacaga
gatgttgagctaaaggaaacatggtttgtcaaattgcagcgctgggaagaagctcttgct
gcgtataagaggcgcgagctgatcgacccagattcattcgatgtcacaatgggaaagatg
aggtgtttgcatgccttaggtgaatggaaaatgctctccgatcttgctcaggaaaagtgg
aaccacgcctccaacgaacatcgaaaggcgatggcgcctcttgcagcgggggcggcatgg
ggtcgtggtcaatgggaacttatggattcgtatattagcgtgatgaaagaacaaaccccg
gaccgatcattctttggcgccatacttgctatccataaccgcaagttcgacgaagcggca
atgttcattgaaaaagcgcgaaatggcctagataccgagctgtctgccttactgggagag
tcttataaccgtgcctacaatgtcgttgtccgtgtccaaatgcttgcagaacttgaggaa
atcatcatatataagcagaatgatgacgatcccgaaaagcaagaagctatgaaagaaaca
tggaataaacgactcctaggttgtcagcaaaatgttgaggtatggcagcgaatgctgaaa
gtcagagccttggttatatcccctcgcgaaaatctcgatatgtggataaaatttgcaaac
ttgtgtcgtaaatcaaatcgcatgggtcttgcagaccgctctctcagctcattagaaggt
ggcgaactcgggacacctccagaggttgcttatgctcgactgaagtatgaatgggctgct
ggacgccaaaaggaggcacttcagatgctaagagactttactattgggttgacagaagaa
ttcgctagatacaatgctgcccttgttgctcatagcgagcatgcgcctgcggacagacct
ggtctcgttaatggtattagtgatcatccggaattagctctcacacgccagcatattggt
gacgtaggtaagttccgacgattactcgctaaaagtcatcttaaacaaggcgaatggcaa
acagcgctgcagagaggtgattggacttccgagggtgtacgtgatgttttgaactcgtat
tcagcggcaacacaatataaccgcgattcgtacaaagcatggcatgcctgggcgctggca
aattttgaagttgtgaacgcgttgagcactcagacgaatcgggaaacggttgttccccat
cacattgttctcgaacatgtcattcccgccattcgaggattcttccgctccatcgcttta
tcgtccaccagttcattgcaagatactctgaggcttctcacgctctggttcacccatggt
ggtgatgccgaagttagcggcgtcgtatctgaagggttctcttcagttattgttgatacg
tggctcgaggttactccacaacttattgcacgcatcaaccaaccaaatgcccgagtccgt
ggagctgtccatcgattactcgcagaagtcggaaaagctcacccacaagctctggtttat
ccattgactgttgcaacgatgtcaaacgtcgtcagacgatctcaatcagcctctcatatt
atggacagcatgaggcagcatagcccgcgactggttgaacaggcagaaatcgtcagccac
gaattgattcgtgtcgcagtcctctggcatgagctttggcatgagggtttggaggaagca
tctcgattatattttggagatcacaatgtcgaaggcatgttcgcgacattagctcctttg
catgacatgcttgacaaaggtgctgagacgcttagagaagtgtcctttgcccaagcattt
ggccgtgaccttgctgaggccaagcatttctgtcttctctaccgcgactcaggagtaata
ggtgacctcaaccaagcgtgggatctctactacactgtcttccgaaagattgcgcgacaa
ctgccccaactgcagtcgcttgacttgaagtacgtctctcccaaattaaaagacgctgtc
gatctcgaactggctgttcctggcacctatcaaagtggcaagcccgtcatcagaatcatg
agctttgatccagtgtccattgttttgcagacgaagaagcgaccacgcaagatgacattg
aaaggtagcgacggaaattcttatatgtatgctcttaaggggcacgaagatatccgtcag
gatgagcgcgttatgcaacttttcggactagttaatacgctccttgatcatgatagtgag
agtttcaagcgtcatttgacaattcaacgtttccctgctattccgttatcacagaactcc
ggtctaattggctgggtatcaaacacggatacattgcatgctttaatcaaagagtaccgt
gaaagtcgccgaattttgcttaatattgagcatcgtatcatgcttcagatggcacctgat
tatgacaacttaaccctcatgcaaaaagttgaagtattcggatatgccatggacaacaca
accggaaaagatctgtatcgcgtcctttggcttaagagcaagagctctgaatcgtggcta
gagagacgaacaaactacaccagatcccttggtgttatgtcaatggttggatatatcctt
ggcctgggtgatcgccatccatcaaatcttctacttgagcggattaccggcaaaatcgtg
catattgatttcggtgactgctttgaaatcgccatgcatcgtgaaaaataccctgaacgc
gttccattccgtcttacacgaatgctcacgttcgctatggaggttagcaacattgagggc
agttatcacataacatgtgaggctgtaatgcgggtgatccgagaaaataaggagtcattg
atggccgtgttagaagccttcatccacgatccactcataaactggcgcctgggtgctcga
gaatcacctgcgcgtccgtcattcgctgctgaccgccgccagtccgttgtcgaggaaata
aacatggaccatccagtgcaaccaagcaatttctcccgtcgacgcccatccattcttgaa
ggtggtattctagatgcgcaacagggtgttcccaacgaagcccgagaagtacagaatgcc
cgagcgctccaggtcctttcacgggtcaaggaaaagttgacaggccgcgattttaagtca
acggaggagctcaatgtctcggaccaggtggacaaattgctggtccaagctacgagcgtg
gagaatctgtgtcagcattatattggatggtgtagtttttggtga

DBGET integrated database retrieval system