KEGG   Paracoccidioides brasiliensis: PAAG_01410Help
Entry
PAAG_01410        CDS       T02230                                 

Definition
phosphatidylinositol 3-kinase tor2
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
pbl  Paracoccidioides brasiliensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2374 aa AA seqDB search
MAQVPSGTDATQRIFHDLKSKHEETRSRASFELHENVAAASRELPPDKFIEYYNAVSQRI
AQFVVTGNDVNEKIGGLLALDRLIDFDGVDAAQKTTRFASYLRSALRSNDSTVLVYAARS
LGRLAKPGGALTAELVESEIQSAMEWLQSERQENRRFAAVLVIRELAKGSPTLLYGFVPQ
IFELIWVALRDQKVLIRETSAQAVSECFEILAARDFQVRQQWFGRIYEECLLGLRSSNVD
WIHGSLLTLRELLLKGAMFMNEHYRNACEIVLRLKDHREPKIRIQIVLTIPILASYAPLE
FTNIYLHRFMIYLQAQLKREKERNAAFIAIGKIANAVGNSIAQFLDGIIVYIREGLTMKA
RNRAAVDEGPMFECISMLSLAVGQTLSKYMEALLDPIFACGLSESLTQALVDMAHYIPPI
KATIQEKLLDMLSIVLCGTPFRPLGCPENRPPPMPSFAKDYGPFLQEPTDSEIALALHTL
GSFDFSGHILNEFVRDVAITFVNNDNPEIRKASALTCCQLFVSDPILNQKSSHSIQVVGE
VVDTLLTVGVGDPDPDIRRIVLESLDKKFDSHLAKPESVRCLFLAVNDEVFPVREAAISI
IGRLSGVNPAYVFPPLRKLLVNLLTGLSFATTSRQKEESAQLISLFVANATKLVRSYVDP
MVTALFPKTTDPNPGVAATTLKAIGELATVGGEDMRQYLPQLMPIILDALQDLSCQSKRE
AALRTLGQLASNAGYVIEPYLEYPHLLAVLINIVKTEQTGSLRKETIKLLGIIGALDPYK
HQQISESVPDIHHINEVQRVSDVSLIMQGLTPSNEEYYPTIVINTLLQNILNESSLAQYH
SAVIDAIVTIFKTLGLKCVPFLGQIIPAFVLVIRSTPTSRLESYFNQLAILVTIVRQHIR
AFLPEIIEVIREFWDSSYQVQATILSLIEAIAKSLEGEFKKYLAGLIPLMLDTLDKDITP
RRQPSERILHTFLIFGSSGEEYMHLIAPAIVRLFDKSQSPSGIRKSAIETLGKLSRQVNV
SDFSSLMIHPLSRVIAGTDRTLRQAALDCVCTLIFQLGQDFNNYIQLINKTISAHQISHH
NYQILVSKLQKGDPLPQDLNPDEHYSTLGDDSTFADVGQKKILVNQQHLKNAWDASQKST
REDWQEWIRRFSVELLKESPSHALRACASLAGIYQPLAKDLFNAAFVSCWTELYDQYQEE
LVRSIDMALTSQNIPPEILQILLNLAEFMEHDDKALHIDIRTLGKYAGKCHAFAKALHYK
ELEFEQDQNSGAVEALISINNQLQQSDAAIGILRKAQAYRDVELKETWFVKLQRWEEALA
AYKRRELIDPDSFDVTMGKMRCLHALGEWKMLSDLAQEKWNHASNEHRKAMAPLAAGAAW
GRGQWELMDSYISVMKEQTPDRSFFGAILAIHNRKFDEAAMFIEKARNGLDTELSALLGE
SYNRAYNVVVRVQMLAELEEIIIYKQNDDDPEKQEAMKETWNKRLLGCQQNVEVWQRMLK
VRALVISPRENLDMWIKFANLCRKSNRMGLADRSLSSLEGGELGTPPEVAYARLKYEWAA
GRQKEALQMLRDFTIGLTEEFARYNAALVAHSEHAPADRPGLVNGISDHPELALTRQHIG
DVGKFRRLLAKSHLKQGEWQTALQRGDWTSEGVRDVLNSYSAATQYNRDSYKAWHAWALA
NFEVVNALSTQTNRETVVPHHIVLEHVIPAIRGFFRSIALSSTSSLQDTLRLLTLWFTHG
GDAEVSGVVSEGFSSVIVDTWLEVTPQLIARINQPNARVRGAVHRLLAEVGKAHPQALVY
PLTVATMSNVVRRSQSASHIMDSMRQHSPRLVEQAEIVSHELIRVAVLWHELWHEGLEEA
SRLYFGDHNVEGMFATLAPLHDMLDKGAETLREVSFAQAFGRDLAEAKHFCLLYRDSGVI
GDLNQAWDLYYTVFRKIARQLPQLQSLDLKYVSPKLKDAVDLELAVPGTYQSGKPVIRIM
SFDPVSIVLQTKKRPRKMTLKGSDGNSYMYALKGHEDIRQDERVMQLFGLVNTLLDHDSE
SFKRHLTIQRFPAIPLSQNSGLIGWVSNTDTLHALIKEYRESRRILLNIEHRIMLQMAPD
YDNLTLMQKVEVFGYAMDNTTGKDLYRVLWLKSKSSESWLERRTNYTRSLGVMSMVGYIL
GLGDRHPSNLLLERITGKIVHIDFGDCFEIAMHREKYPERVPFRLTRMLTFAMEVSNIEG
SYHITCEAVMRVIRENKESLMAVLEAFIHDPLINWRLGARESPARPSFAADRRQSVVEEI
NMDHPVQPSNFSRRRPSILEGGILDAQQGVPNEAREVQNARALQVLSRVKEKLTGRDFKS
TEELNVSDQVDKLLVQATSVENLCQHYIGWCSFW
NT seq 7125 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggtaccttcgggaacagacgcaacccagcggattttccatgaccttaagtcc
aagcatgaagaaacacgctcccgtgcttccttcgagctccatgagaatgttgccgctgcc
tctagagagctaccaccggacaagttcatcgaatactacaatgcggtatcccagcgtatc
gctcaatttgttgttactggcaatgacgtaaacgagaagatcggtggcctcctggccctc
gacaggttgatagattttgatggcgtagatgctgctcaaaaaacgacacgatttgcaagc
tatctgcggagtgcacttcgcagcaacgacagcaccgtcctagtctatgctgcgcgttca
cttggccgtctggcaaaacccggcggtgcattgacggcagaattggtagaaagcgaaata
caatctgctatggaatggctgcagtcagaaaggcaggaaaacaggcgttttgctgctgtt
ctagtgatccgggaacttgcgaagggatcccccactttgctctacggctttgtgccgcag
atattcgagcttatctgggtggcactgcgtgaccaaaaggttctgattagagagacatct
gctcaggccgttagcgaatgcttcgaaattctggctgcaagagatttccaagtccgtcag
cagtggtttggtcggatatatgaagaatgtttgctaggactgagatcaagcaatgtagat
tggattcacggctcgcttctgaccttgagggagctcctgttgaagggcgctatgttcatg
aacgagcattaccgaaatgcctgtgaaattgtccttcgcctcaaggatcaccgtgagccg
aagattcgaatacaaattgtccttaccatcccgattctcgcatcttatgcacctctagaa
ttcaccaacatatatttacacagatttatgatatatctacaggcacagctaaagagggag
aaggagagaaatgctgccttcattgccatcggaaaaatcgcgaatgccgttggaaattct
attgcacagtttcttgatgggattattgtctatatccgggaaggactgacaatgaaagct
cgtaaccgtgctgcggtcgatgaaggtccgatgtttgagtgcataagcatgctgtcttta
gctgttggacaaaccctcagcaaatacatggaagccttattggatccaatctttgcatgc
ggtctgagcgaatctctcacacaggctttggtagatatggcgcattatatccctcccatt
aaggcaacgattcaagaaaaactgcttgatatgttaagcatagtcctatgtggaacccca
tttaggccccttgggtgccctgaaaaccgccctcccccaatgccctcctttgcaaaagat
tatggacctttcctgcaagaaccaactgatagcgaaattgctcttgcattacatacgctc
ggcagttttgatttctctgggcatattttaaacgaatttgtccgcgacgttgctattaca
tttgtcaataatgacaacccggaaatccgtaaagcgtcagccttaacatgttgtcaacta
ttcgtcagcgacccaattcttaatcaaaagagcagccactccatccaggtagttggtgag
gttgtcgacactctcctcactgttggtgtcggagaccctgatccagatattcgacgaatt
gtcctggagtccttggataagaaatttgacagtcacttggccaaacctgaaagtgttcga
tgccttttcctggccgtgaacgatgaagtatttcccgttcgggaagccgcaattagtatc
atcggccgcctgtccggcgtcaatccagcatacgttttccctccgttaagaaaactgctg
gtgaacctgttgactggacttagctttgctaccacatcccgacaaaaggaagaaagcgcc
cagctaattagcctgttcgttgcgaatgctacgaagcttgttcgatcgtatgttgaccct
atggtgactgctctatttccgaaaacaacagatcccaatccaggagtggcggcgacaact
ttgaaggccatcggagagcttgcaacagttgggggagaggatatgaggcaatatttaccg
caactcatgcccattatcctggatgcacttcaggatctatcgtgccaatccaaaagagaa
gcagcgctacgaaccctggggcagcttgcaagtaacgcaggatatgtcatcgagccctac
cttgaatatccccaccttcttgctgttcttatcaatattgttaaaactgaacaaactggg
tctcttaggaaagagaccataaagctgctaggtattatcggtgctttggatccgtataaa
caccagcaaataagtgaatcggtaccagatatacatcatatcaatgaagtccagcgggta
tcagacgtgtcccttattatgcaaggcctgacgccctctaacgaagagtactatcccacc
attgttatcaacaccctgctccaaaatattctcaacgagagttctctcgcccaatatcac
tcagctgttatcgatgctattgtgacgatattcaagaccctgggattgaagtgtgttccg
ttcttggggcaaattatccctgccttcgtattagttattaggagtactccgactagtcgt
cttgaatcttacttcaaccaactagcaatcctagtgaccatcgtgaggcaacacatccgt
gccttcctgccagaaataatcgaggtcattcgtgaattctgggattcctcttaccaagtc
caagcgacgatattgtcacttatcgaggcaattgcaaagtcactggagggggaattcaag
aaatacttggctggcctgatcccacttatgcttgacacgttagataaggatatcacacca
agacgtcaaccctcagaaagaattttgcacacatttcttatattcggctctagtggagag
gaatacatgcatttgatcgccccggctattgttcgcttatttgataaaagccagagtccc
tccggaattcgaaagtccgccattgaaactctggggaaactctctcgccaggttaacgta
tctgacttctcgtctcttatgatacatccactgtcaagggtgatcgcaggcaccgatcgt
acccttcggcaggcggcgctggattgtgtctgcacgctcatattccaactcggccaggac
ttcaacaactatatccagcttatcaacaaaaccatttcagcccaccaaattagtcatcac
aattatcaaattctagtttcgaaactacagaaaggagatcctttgcctcaggatctgaac
ccggatgagcactatagcacccttggcgatgattctacgttcgctgatgtcggccagaag
aagattctagttaatcagcagcatttgaagaatgcatgggacgcgtctcaaaaatcgaca
cgagaggattggcaagagtggattcgacgattcagtgttgaactacttaaggaatctcca
tctcacgctcttcgggcgtgcgccagtttagccggaatataccagcctcttgcgaaagat
cttttcaatgccgcttttgtctcgtgctggacggaactgtatgaccaataccaggaagag
ctcgttcgttcaatagacatggcccttacctcacagaatattccccccgagatcttacag
atcctcctcaatcttgcagagtttatggaacatgacgacaaggcgcttcatatcgatatt
cgaacccttggaaaatatgctggtaaatgtcacgcatttgctaaagctcttcattataag
gaattggaattcgaacaagaccaaaattccggcgctgtggaagccttaatcagcatcaat
aatcaactccagcaatcagatgctgctattggaatacttcggaaggctcaggcttacaga
gatgttgagctaaaggaaacatggtttgtcaaattgcagcgctgggaagaagctcttgct
gcgtataagaggcgcgagctgatcgacccagattcattcgatgtcacaatgggaaagatg
aggtgtttgcatgccttaggtgaatggaaaatgctctccgatcttgctcaggaaaagtgg
aaccacgcctccaacgaacatcgaaaggcgatggcgcctcttgcagcgggggcggcatgg
ggtcgtggtcaatgggaacttatggattcgtatattagcgtgatgaaagaacaaaccccg
gaccgatcattctttggcgccatacttgctatccataaccgcaagttcgacgaagcggca
atgttcattgaaaaagcgcgaaatggcctagataccgagctgtctgccttactgggagag
tcttataaccgtgcctacaatgtcgttgtccgtgtccaaatgcttgcagaacttgaggaa
atcatcatatataagcagaatgatgacgatcccgaaaagcaagaagctatgaaagaaaca
tggaataaacgactcctaggttgtcagcaaaatgttgaggtatggcagcgaatgctgaaa
gtcagagccttggttatatcccctcgcgaaaatctcgatatgtggataaaatttgcaaac
ttgtgtcgtaaatcaaatcgcatgggtcttgcagaccgctctctcagctcattagaaggt
ggcgaactcgggacacctccagaggttgcttatgctcgactgaagtatgaatgggctgct
ggacgccaaaaggaggcacttcagatgctaagagactttactattgggttgacagaagaa
ttcgctagatacaatgctgcccttgttgctcatagcgagcatgcgcctgcggacagacct
ggtctcgttaatggtattagtgatcatccggaattagctctcacacgccagcatattggt
gacgtaggtaagttccgacgattactcgctaaaagtcatcttaaacaaggcgaatggcaa
acagcgctgcagagaggtgattggacttccgagggtgtacgtgatgttttgaactcgtat
tcagcggcaacacaatataaccgcgattcgtacaaagcatggcatgcctgggcgctggca
aattttgaagttgtgaacgcgttgagcactcagacgaatcgggaaacggttgttccccat
cacattgttctcgaacatgtcattcccgccattcgaggattcttccgctccatcgcttta
tcgtccaccagttcattgcaagatactctgaggcttctcacgctctggttcacccatggt
ggtgatgccgaagttagcggcgtcgtatctgaagggttctcttcagttattgttgatacg
tggctcgaggttactccacaacttattgcacgcatcaaccaaccaaatgcccgagtccgt
ggagctgtccatcgattactcgcagaagtcggaaaagctcacccacaagctctggtttat
ccattgactgttgcaacgatgtcaaacgtcgtcagacgatctcaatcagcctctcatatt
atggacagcatgaggcagcatagcccgcgactggttgaacaggcagaaatcgtcagccac
gaattgattcgtgtcgcagtcctctggcatgagctttggcatgagggtttggaggaagca
tctcgattatattttggagatcacaatgtcgaaggcatgttcgcgacattagctcctttg
catgacatgcttgacaaaggtgctgagacgcttagagaagtgtcctttgcccaagcattt
ggccgtgaccttgctgaggccaagcatttctgtcttctctaccgcgactcaggagtaata
ggtgacctcaaccaagcgtgggatctctactacactgtcttccgaaagattgcgcgacaa
ctgccccaactgcagtcgcttgacttgaagtacgtctctcccaaattaaaagacgctgtc
gatctcgaactggctgttcctggcacctatcaaagtggcaagcccgtcatcagaatcatg
agctttgatccagtgtccattgttttgcagacgaagaagcgaccacgcaagatgacattg
aaaggtagcgacggaaattcttatatgtatgctcttaaggggcacgaagatatccgtcag
gatgagcgcgttatgcaacttttcggactagttaatacgctccttgatcatgatagtgag
agtttcaagcgtcatttgacaattcaacgtttccctgctattccgttatcacagaactcc
ggtctaattggctgggtatcaaacacggatacattgcatgctttaatcaaagagtaccgt
gaaagtcgccgaattttgcttaatattgagcatcgtatcatgcttcagatggcacctgat
tatgacaacttaaccctcatgcaaaaagttgaagtattcggatatgccatggacaacaca
accggaaaagatctgtatcgcgtcctttggcttaagagcaagagctctgaatcgtggcta
gagagacgaacaaactacaccagatcccttggtgttatgtcaatggttggatatatcctt
ggcctgggtgatcgccatccatcaaatcttctacttgagcggattaccggcaaaatcgtg
catattgatttcggtgactgctttgaaatcgccatgcatcgtgaaaaataccctgaacgc
gttccattccgtcttacacgaatgctcacgttcgctatggaggttagcaacattgagggc
agttatcacataacatgtgaggctgtaatgcgggtgatccgagaaaataaggagtcattg
atggccgtgttagaagccttcatccacgatccactcataaactggcgcctgggtgctcga
gaatcacctgcgcgtccgtcattcgctgctgaccgccgccagtccgttgtcgaggaaata
aacatggaccatccagtgcaaccaagcaatttctcccgtcgacgcccatccattcttgaa
ggtggtattctagatgcgcaacagggtgttcccaacgaagcccgagaagtacagaatgcc
cgagcgctccaggtcctttcacgggtcaaggaaaagttgacaggccgcgattttaagtca
acggaggagctcaatgtctcggaccaggtggacaaattgctggtccaagctacgagcgtg
gagaatctgtgtcagcattatattggatggtgtagtttttggtga

DBGET integrated database retrieval system