KEGG   Paracoccidioides lutzii Pb01: PAAG_01583Help
Entry
PAAG_01583        CDS       T02230                                 

Definition
(RefSeq) 6-phosphofructokinase subunit beta
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAAG_01583
   01230 Biosynthesis of amino acids
    PAAG_01583
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAAG_01583
   00030 Pentose phosphate pathway
    PAAG_01583
   00051 Fructose and mannose metabolism
    PAAG_01583
   00052 Galactose metabolism
    PAAG_01583
  Energy metabolism
   00680 Methane metabolism
    PAAG_01583
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PAAG_01583
Enzymes [BR:pbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PAAG_01583
Protein phosphatases and associated proteins [BR:pbl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PAAG_01583
Messenger RNA biogenesis [BR:pbl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PAAG_01583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 800 aa AA seqDB search
MANVTNISPVSQSKRRRVAVLTSGGDAPGMNGVVRAVIRMSIHCGCEAYAVHEGYEGLVR
GGDLIRRMHWEDVRGWLSRGGTLIGSARCKSFMERDGRLQAAKNMVVRGIDALVVCGGDG
SLTGADIFRSEWPGLLDELVKRGDLTDEQVLLFKTLNIVGIVGSIDNDMSTTDATVGCYT
SLHRICEAVDEVFDTAASHQRGFVIEVMGRNCGWLALMSAISTGADWLFIPERPPRDGWE
DDMCDIITQNRKRGKRRTIVIVAEGAQDANLNKISSSSVKDVLSNRLKLDTRVTVLGHTQ
RGGTACAYDRWLGTLQGIEAVKAVLEAKPGDPSPLITLRENKIERSSLVEAVRVTKTVGQ
ALKDKDFATALSMRDAEFKAYHRAYINTATPHHPKMQLPENMRMRIAIIHVGAPAGGMNP
ATRAAVAYCLARGHTPIAIYNGFPGLCRHHADTPIGSVREVKWLESDSWVNEGGSEIGTN
RGLPSADMAKTAECFELHKFDALFVIGGFEAFTAVSQLRKAREQYPAFKIPLVILPATIS
NNVPGTEYSLGSDTCLNTLVNFCDVIRQSASSSRRRVFVIETQGGRSGYIATMAGFAVGA
YAVYIPEEGIDIKMLARDIEYLRHNFATDRGASHAGKIILRNETVSKTYTTQVVADMIKE
EAKGRFESRAAVPGHFQQGGKPSPMDRVRALRMAIKCVQHIEQFQGRSKDEIAADPMSSV
VIGIKGSEVVFGPMSGERGLEETDTDWERRRPKNDFWLKLKSLVDTLSGRPGEDHDGVLQ
MSEEEGWGAYAPLDECHFTE
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgtcacgaacatttctccggtgagccagtccaaacgccgtcgtgttgccgtg
ttaacaagcggtggcgacgccccgggtatgaacggtgtggttcgcgccgttatccgtatg
tcaatccattgcggttgtgaggcctatgctgtccatgaaggatatgagggtctagtacga
ggtggggacctgataaggcggatgcattgggaagatgtgcgtggctggctttcgcggggt
ggtactctgatcggctctgcgagatgcaaatcattcatggagcgggatggccgcctgcag
gctgccaagaacatggtggtgcgtgggattgatgctttggttgtatgcggtggcgatggg
agtcttacaggggctgacatcttccgctcggaatggcctgggttgctggacgaattagtg
aaaaggggagacttaacggatgagcaggtgttgctatttaaaacactgaatatagtgggt
attgttgggtccattgataatgatatgtcgacaactgatgcgactgttggttgttacacg
tctctccatcgtatatgtgaggctgttgatgaggtcttcgatacggcggcttcccaccaa
cgtggcttcgtaattgaagttatgggacggaattgtggctggctggcattgatgtctgcc
attagtacaggagcagactggttattcattccagaaaggccaccacgagatggctgggaa
gacgacatgtgtgacatcatcactcagaaccgaaaacgaggcaaacgcaggacaattgtt
atcgtggccgagggcgcgcaagatgccaacctaaataagatatcttcctcatctgttaaa
gatgttctgagcaacaggctaaaacttgatacgcgcgtcaccgttctgggccacacccag
cgaggagggacagcgtgtgcttatgatcggtggctaggcaccttacaggggatagaagct
gtcaaggcggtattggaggccaagcctggcgacccctcgcctctgatcacactcagggag
aataaaatcgaacgctcgtctcttgtcgaagccgttcgggtcaccaaaaccgtcggccag
gctctcaaagacaaggatttcgccacggccctgtcaatgcgagatgcagaattcaaagcc
tatcatagagcgtacatcaacaccgcgacccctcatcatccaaagatgcaacttcctgaa
aacatgcgtatgcgaattgcaattatccatgttggagcaccagctggtggcatgaacccc
gcgacacgggcagctgtagcctattgtttagccagaggacacaccccaattgccatttac
aacggattccctgggttatgccgacaccatgcagatacaccaataggctcagttcgggaa
gttaaatggctggagtccgactcgtgggtgaacgaaggcggctctgaaattggcacaaat
cgcggtctaccatccgcggacatggccaagacagctgaatgctttgagttgcataaattc
gatgcactcttcgtcattggtggcttcgaggcattcacagccgttagccagctgcgcaag
gcccgcgagcagtacccagcttttaaaatccctctcgtcatcctccccgccacgatctcc
aataacgtcccaggcactgaatactcactaggcagcgatacctgtctgaacaccctcgtt
aacttctgcgatgtaatccggcagtcagcctcctcctcacgccgccgtgtcttcgtcata
gaaacccagggcggccgctccggctacattgccaccatggctggatttgccgtgggcgcc
tacgcagtctacatcccagaggaaggaatcgacattaaaatgctagcccgcgatatagaa
tatctacggcataacttcgccacagaccgcggcgccagccacgcgggcaagatcatccta
cgcaatgaaactgtatcgaaaacatatacgacccaagtggtggcagatatgatcaaggag
gaagcaaagggccgctttgaatcccgcgccgcggtgccgggccacttccagcagggcggg
aagccgtcgcccatggaccgggtgcgcgcgttgcgcatggcgattaaatgcgtgcagcac
atagagcagttccagggccggagcaaggacgagattgcagccgatccgatgtccagtgtc
gttattgggatcaaagggagcgaggtggtttttgggccgatgtcgggcgagaggggattg
gaggagacggatacagattgggaacgccgtcggccgaagaatgacttttggttgaagttg
aaatcattggttgatacgcttagtgggaggcctggggaggatcatgatggggtgctgcag
atgtcagaggaggagggctggggggcgtatgcgccgttggatgagtgtcattttacggag
tag

DBGET integrated database retrieval system