KEGG   Paracoccidioides brasiliensis: PAAG_01583Help
Entry
PAAG_01583        CDS       T02230                                 

Definition
6-phosphofructokinase subunit beta
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAAG_01583
   01230 Biosynthesis of amino acids
    PAAG_01583
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAAG_01583
   00030 Pentose phosphate pathway
    PAAG_01583
   00051 Fructose and mannose metabolism
    PAAG_01583
   00052 Galactose metabolism
    PAAG_01583
  Energy metabolism
   00680 Methane metabolism
    PAAG_01583
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PAAG_01583
Enzymes [BR:pbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PAAG_01583
Protein phosphatases and associated proteins [BR:pbl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PAAG_01583
Messenger RNA biogenesis [BR:pbl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PAAG_01583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 800 aa AA seqDB search
MANVTNISPVSQSKRRRVAVLTSGGDAPGMNGVVRAVIRMSIHCGCEAYAVHEGYEGLVR
GGDLIRRMHWEDVRGWLSRGGTLIGSARCKSFMERDGRLQAAKNMVVRGIDALVVCGGDG
SLTGADIFRSEWPGLLDELVKRGDLTDEQVLLFKTLNIVGIVGSIDNDMSTTDATVGCYT
SLHRICEAVDEVFDTAASHQRGFVIEVMGRNCGWLALMSAISTGADWLFIPERPPRDGWE
DDMCDIITQNRKRGKRRTIVIVAEGAQDANLNKISSSSVKDVLSNRLKLDTRVTVLGHTQ
RGGTACAYDRWLGTLQGIEAVKAVLEAKPGDPSPLITLRENKIERSSLVEAVRVTKTVGQ
ALKDKDFATALSMRDAEFKAYHRAYINTATPHHPKMQLPENMRMRIAIIHVGAPAGGMNP
ATRAAVAYCLARGHTPIAIYNGFPGLCRHHADTPIGSVREVKWLESDSWVNEGGSEIGTN
RGLPSADMAKTAECFELHKFDALFVIGGFEAFTAVSQLRKAREQYPAFKIPLVILPATIS
NNVPGTEYSLGSDTCLNTLVNFCDVIRQSASSSRRRVFVIETQGGRSGYIATMAGFAVGA
YAVYIPEEGIDIKMLARDIEYLRHNFATDRGASHAGKIILRNETVSKTYTTQVVADMIKE
EAKGRFESRAAVPGHFQQGGKPSPMDRVRALRMAIKCVQHIEQFQGRSKDEIAADPMSSV
VIGIKGSEVVFGPMSGERGLEETDTDWERRRPKNDFWLKLKSLVDTLSGRPGEDHDGVLQ
MSEEEGWGAYAPLDECHFTE
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgtcacgaacatttctccggtgagccagtccaaacgccgtcgtgttgccgtg
ttaacaagcggtggcgacgccccgggtatgaacggtgtggttcgcgccgttatccgtatg
tcaatccattgcggttgtgaggcctatgctgtccatgaaggatatgagggtctagtacga
ggtggggacctgataaggcggatgcattgggaagatgtgcgtggctggctttcgcggggt
ggtactctgatcggctctgcgagatgcaaatcattcatggagcgggatggccgcctgcag
gctgccaagaacatggtggtgcgtgggattgatgctttggttgtatgcggtggcgatggg
agtcttacaggggctgacatcttccgctcggaatggcctgggttgctggacgaattagtg
aaaaggggagacttaacggatgagcaggtgttgctatttaaaacactgaatatagtgggt
attgttgggtccattgataatgatatgtcgacaactgatgcgactgttggttgttacacg
tctctccatcgtatatgtgaggctgttgatgaggtcttcgatacggcggcttcccaccaa
cgtggcttcgtaattgaagttatgggacggaattgtggctggctggcattgatgtctgcc
attagtacaggagcagactggttattcattccagaaaggccaccacgagatggctgggaa
gacgacatgtgtgacatcatcactcagaaccgaaaacgaggcaaacgcaggacaattgtt
atcgtggccgagggcgcgcaagatgccaacctaaataagatatcttcctcatctgttaaa
gatgttctgagcaacaggctaaaacttgatacgcgcgtcaccgttctgggccacacccag
cgaggagggacagcgtgtgcttatgatcggtggctaggcaccttacaggggatagaagct
gtcaaggcggtattggaggccaagcctggcgacccctcgcctctgatcacactcagggag
aataaaatcgaacgctcgtctcttgtcgaagccgttcgggtcaccaaaaccgtcggccag
gctctcaaagacaaggatttcgccacggccctgtcaatgcgagatgcagaattcaaagcc
tatcatagagcgtacatcaacaccgcgacccctcatcatccaaagatgcaacttcctgaa
aacatgcgtatgcgaattgcaattatccatgttggagcaccagctggtggcatgaacccc
gcgacacgggcagctgtagcctattgtttagccagaggacacaccccaattgccatttac
aacggattccctgggttatgccgacaccatgcagatacaccaataggctcagttcgggaa
gttaaatggctggagtccgactcgtgggtgaacgaaggcggctctgaaattggcacaaat
cgcggtctaccatccgcggacatggccaagacagctgaatgctttgagttgcataaattc
gatgcactcttcgtcattggtggcttcgaggcattcacagccgttagccagctgcgcaag
gcccgcgagcagtacccagcttttaaaatccctctcgtcatcctccccgccacgatctcc
aataacgtcccaggcactgaatactcactaggcagcgatacctgtctgaacaccctcgtt
aacttctgcgatgtaatccggcagtcagcctcctcctcacgccgccgtgtcttcgtcata
gaaacccagggcggccgctccggctacattgccaccatggctggatttgccgtgggcgcc
tacgcagtctacatcccagaggaaggaatcgacattaaaatgctagcccgcgatatagaa
tatctacggcataacttcgccacagaccgcggcgccagccacgcgggcaagatcatccta
cgcaatgaaactgtatcgaaaacatatacgacccaagtggtggcagatatgatcaaggag
gaagcaaagggccgctttgaatcccgcgccgcggtgccgggccacttccagcagggcggg
aagccgtcgcccatggaccgggtgcgcgcgttgcgcatggcgattaaatgcgtgcagcac
atagagcagttccagggccggagcaaggacgagattgcagccgatccgatgtccagtgtc
gttattgggatcaaagggagcgaggtggtttttgggccgatgtcgggcgagaggggattg
gaggagacggatacagattgggaacgccgtcggccgaagaatgacttttggttgaagttg
aaatcattggttgatacgcttagtgggaggcctggggaggatcatgatggggtgctgcag
atgtcagaggaggagggctggggggcgtatgcgccgttggatgagtgtcattttacggag
tag

DBGET integrated database retrieval system