KEGG   Paracoccidioides brasiliensis: PAAG_01583Help
Entry
PAAG_01583        CDS       T02230                                 

Definition
6-phosphofructokinase subunit beta
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:pbl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pbl01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pbl00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pbl00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pbl00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pbl00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:pbl00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 800 aa AA seqDB search
MANVTNISPVSQSKRRRVAVLTSGGDAPGMNGVVRAVIRMSIHCGCEAYAVHEGYEGLVR
GGDLIRRMHWEDVRGWLSRGGTLIGSARCKSFMERDGRLQAAKNMVVRGIDALVVCGGDG
SLTGADIFRSEWPGLLDELVKRGDLTDEQVLLFKTLNIVGIVGSIDNDMSTTDATVGCYT
SLHRICEAVDEVFDTAASHQRGFVIEVMGRNCGWLALMSAISTGADWLFIPERPPRDGWE
DDMCDIITQNRKRGKRRTIVIVAEGAQDANLNKISSSSVKDVLSNRLKLDTRVTVLGHTQ
RGGTACAYDRWLGTLQGIEAVKAVLEAKPGDPSPLITLRENKIERSSLVEAVRVTKTVGQ
ALKDKDFATALSMRDAEFKAYHRAYINTATPHHPKMQLPENMRMRIAIIHVGAPAGGMNP
ATRAAVAYCLARGHTPIAIYNGFPGLCRHHADTPIGSVREVKWLESDSWVNEGGSEIGTN
RGLPSADMAKTAECFELHKFDALFVIGGFEAFTAVSQLRKAREQYPAFKIPLVILPATIS
NNVPGTEYSLGSDTCLNTLVNFCDVIRQSASSSRRRVFVIETQGGRSGYIATMAGFAVGA
YAVYIPEEGIDIKMLARDIEYLRHNFATDRGASHAGKIILRNETVSKTYTTQVVADMIKE
EAKGRFESRAAVPGHFQQGGKPSPMDRVRALRMAIKCVQHIEQFQGRSKDEIAADPMSSV
VIGIKGSEVVFGPMSGERGLEETDTDWERRRPKNDFWLKLKSLVDTLSGRPGEDHDGVLQ
MSEEEGWGAYAPLDECHFTE
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgtcacgaacatttctccggtgagccagtccaaacgccgtcgtgttgccgtg
ttaacaagcggtggcgacgccccgggtatgaacggtgtggttcgcgccgttatccgtatg
tcaatccattgcggttgtgaggcctatgctgtccatgaaggatatgagggtctagtacga
ggtggggacctgataaggcggatgcattgggaagatgtgcgtggctggctttcgcggggt
ggtactctgatcggctctgcgagatgcaaatcattcatggagcgggatggccgcctgcag
gctgccaagaacatggtggtgcgtgggattgatgctttggttgtatgcggtggcgatggg
agtcttacaggggctgacatcttccgctcggaatggcctgggttgctggacgaattagtg
aaaaggggagacttaacggatgagcaggtgttgctatttaaaacactgaatatagtgggt
attgttgggtccattgataatgatatgtcgacaactgatgcgactgttggttgttacacg
tctctccatcgtatatgtgaggctgttgatgaggtcttcgatacggcggcttcccaccaa
cgtggcttcgtaattgaagttatgggacggaattgtggctggctggcattgatgtctgcc
attagtacaggagcagactggttattcattccagaaaggccaccacgagatggctgggaa
gacgacatgtgtgacatcatcactcagaaccgaaaacgaggcaaacgcaggacaattgtt
atcgtggccgagggcgcgcaagatgccaacctaaataagatatcttcctcatctgttaaa
gatgttctgagcaacaggctaaaacttgatacgcgcgtcaccgttctgggccacacccag
cgaggagggacagcgtgtgcttatgatcggtggctaggcaccttacaggggatagaagct
gtcaaggcggtattggaggccaagcctggcgacccctcgcctctgatcacactcagggag
aataaaatcgaacgctcgtctcttgtcgaagccgttcgggtcaccaaaaccgtcggccag
gctctcaaagacaaggatttcgccacggccctgtcaatgcgagatgcagaattcaaagcc
tatcatagagcgtacatcaacaccgcgacccctcatcatccaaagatgcaacttcctgaa
aacatgcgtatgcgaattgcaattatccatgttggagcaccagctggtggcatgaacccc
gcgacacgggcagctgtagcctattgtttagccagaggacacaccccaattgccatttac
aacggattccctgggttatgccgacaccatgcagatacaccaataggctcagttcgggaa
gttaaatggctggagtccgactcgtgggtgaacgaaggcggctctgaaattggcacaaat
cgcggtctaccatccgcggacatggccaagacagctgaatgctttgagttgcataaattc
gatgcactcttcgtcattggtggcttcgaggcattcacagccgttagccagctgcgcaag
gcccgcgagcagtacccagcttttaaaatccctctcgtcatcctccccgccacgatctcc
aataacgtcccaggcactgaatactcactaggcagcgatacctgtctgaacaccctcgtt
aacttctgcgatgtaatccggcagtcagcctcctcctcacgccgccgtgtcttcgtcata
gaaacccagggcggccgctccggctacattgccaccatggctggatttgccgtgggcgcc
tacgcagtctacatcccagaggaaggaatcgacattaaaatgctagcccgcgatatagaa
tatctacggcataacttcgccacagaccgcggcgccagccacgcgggcaagatcatccta
cgcaatgaaactgtatcgaaaacatatacgacccaagtggtggcagatatgatcaaggag
gaagcaaagggccgctttgaatcccgcgccgcggtgccgggccacttccagcagggcggg
aagccgtcgcccatggaccgggtgcgcgcgttgcgcatggcgattaaatgcgtgcagcac
atagagcagttccagggccggagcaaggacgagattgcagccgatccgatgtccagtgtc
gttattgggatcaaagggagcgaggtggtttttgggccgatgtcgggcgagaggggattg
gaggagacggatacagattgggaacgccgtcggccgaagaatgacttttggttgaagttg
aaatcattggttgatacgcttagtgggaggcctggggaggatcatgatggggtgctgcag
atgtcagaggaggagggctggggggcgtatgcgccgttggatgagtgtcattttacggag
tag

DBGET integrated database retrieval system