KEGG   Paracoccidioides brasiliensis: PAAG_01586Help
Entry
PAAG_01586        CDS       T02230                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PAAG_01586
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PAAG_01586
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1160 aa AA seqDB search
MDQKKSVHPDIVARAMVDTTIAIIPASAFRRLTRVYPRATAHIIQVILTRLQRVTFATAH
SYLGLTTEVLSIERQMNKYTSYDLPNHLRGAALDRLKDKFTKERDRLGPEEGTKGIALHN
PSVSRRRRSSSALRKDAALYAKISSAQARHPVHDVTRLPEKEANGVSPGDLLSTIQLSRY
GPRYGYDRLKGFTQEHSTTLNSPTTPFPSPALHGKPPPFSLISQSPSYYMQESIDEDYIF
RESILDCMVKALGLTGSTNEALRKSHNSGDASPQLVSYDFKRQKAAFNNAFGFIDPYDSF
GDADSESLMSMSVTSAGGTSPIVNLKAELRDEIEIVFFPKGSLLVEQGERSPGLYYVIDG
FLDVGIPVNDKSEDLLRPCDASRLESARMPKPLKRPAASRASSSIRGGQIQRRGPVTRTS
LYMVKPGGIDGYVGSITSSRSFTDVTAKTDVYVGFLPRACLERIADKHPLVLLTMAKRLT
TVLPRLILHIDFALEWVQVNAGEVIYHQGDESDAIYIVLNGRLRSLWEKGDGKVSVMGEY
GQGDSVGELEVMTESTRPATLHAIRDTELAKFPKTLFNSLAQEHPNITIQISKLIAQRMK
HIILNPLIEKPNDKGIQESAMTGTSTLNLRTVAILPVTAGVPVVEFGNRLLNAFNQIGVT
NGVAALHQADILNHLGRHAFSRMGKLKLSQYLADLEERYGMVLYVTDTNVNAPWTQTCIT
QADCILLVGVAEGSPSIGEYERFLLGMKTTARKELVLLHLDRYSPPGLTRQWLKNRMWIN
GGHHHIQMSFRLTTEPSHPVTKRFGTVLKQRVQVLQAELQKYTSRRIHQTPLYSATTPFK
GDFHRLARRLCGKSVGLVLGGGGARGIAHVGVIKALEEAGVPIDIIGGTSIGAFIGALYA
RDADVVPLYGRAKKFAGRMGSIWRFALDLTYPSASYTTGHEFNRGIFKAFGDSQIEDFWL
EFYCNTTNISKSCNEFHTSGYVWRYVRASMSLAGLLPPMCDEGNMLLDGGYVDNLPVSRM
KSLGADVIFAIDVGSIDDNTPQAYGDSLSGFWALVNRWNPFSSLANPPTLAEIQARLAYV
SSFSALETAKNTPGCLYMRPPIDAFGTLDFAKFDEIYKIGYAYGREFLERLKNEGGLPIP
DETEEKKNLRRTMAPRRASI
NT seq 3483 nt NT seq  +upstreamnt  +downstreamnt
atggatcagaaaaaatctgtccatccagacatcgtggcacgcgcgatggtagacactacc
attgccatcatccctgcaagcgctttccgccgcctaacccgggtctatcctcgagcaacg
gcgcatataatccaggtcattcttaccagactccaacgagttacatttgctacggcgcat
tcatacctaggcttgactacggaagtcctgagtattgagaggcagatgaataaatacacc
tcatatgaccttccgaatcatcttcgcggagcggcgctagacaggctaaaggataaattt
acaaaagagagagatcgcctaggtccagaggagggtacaaaagggattgctcttcacaat
ccttccgtttcgaggaggcgccgatcgagtagcgctttgcggaaggacgctgcattatac
gctaaaatctcttccgctcaggccaggcatccagtccacgatgtaacacgcctccctgaa
aaggaagccaatggcgtgagtccgggagacttactttctaccattcaactctctcgttat
ggccctcgttatggatatgatcgtcttaagggtttcacccaagagcattctacgacttta
aatagtcccacaactcccttcccatcccctgctttacacggaaaacctcctccttttagc
ctaattagtcaaagtccttcatattacatgcaggagtcgattgacgaggattacattttt
cgcgagtctatcctcgattgtatggtaaaagctctcggccttacaggaagcacaaacgag
gcacttcgaaaatcccataactcgggagatgcgtctccacaactagtctcatacgatttc
aaacgtcagaaggctgcctttaacaatgcctttggttttatagatccgtacgattcattc
ggcgatgcggattctgaatcgctcatgtctatgtctgttaccagcgctggagggacttcg
cctattgtcaaccttaaggcggagctgcgggacgagatagaaattgtatttttcccgaaa
ggttcattacttgtcgaacaaggggagcggagcccaggtctttattatgttatcgacgga
tttttggacgttggcataccagtcaatgacaaaagcgaggatcttttgcgaccttgtgat
gcgtcacgtcttgaatcagccagaatgcctaaaccacttaaacgacccgccgcctctcga
gcttcatcttccataaggggtggccaaattcagcggaggggacccgtgacacgcacatcc
ttatatatggtaaagcccggcggcattgatggttatgttgggtccattacttcctctaga
tcttttacggacgttacagcgaaaacagacgtttatgttggctttcttcctcgggcgtgt
ctcgaaaggatcgctgacaagcatccacttgtgcttttaacgatggcgaagcgccttact
acggtccttcctcgcctaattttgcatattgattttgctctagaatgggttcaagttaac
gccggcgaagttatttatcaccaaggcgatgaaagcgatgcgatctacattgtccttaat
ggtcgtcttcggtctctttgggagaaaggtgatggtaaagtgagtgtcatgggagagtat
ggtcaaggggatagtgttggggagttggaagttatgactgagtcgacgcggcccgctacc
ctccatgccatccgtgatactgaactagcaaaattcccgaaaactctgttcaatagtctt
gcacaggaacatcccaacattaccatccaaatctccaaactgatcgcccagagaatgaag
cacattattcttaacccgcttatagagaagcccaacgacaaaggcattcaagaaagcgcg
atgactggaacctctactttaaatctccgcactgttgccattttgccagtcactgctggt
gtccccgttgtagaatttgggaaccgccttttgaatgcatttaaccagattggtgtcacc
aacggggtggctgctctacatcaagcggatatcctcaatcatttgggccgccatgcattc
agcagaatgggtaagttgaaactatcccagtatctagcagatttggaggagagatatggt
atggtactatacgttacagatacaaatgtgaatgctccttggacccaaacttgcattacc
caggcagattgtatccttttggtcggggtcgctgagggctcccctagtattggcgaatat
gaacgattccttcttggtatgaaaactactgctaggaaggagctcgtactcctgcatctg
gatagatactcgcccccagggcttaccagacaatggctaaaaaatcgcatgtggatcaac
ggcggacaccatcacatccaaatgtcgtttcgtttaacgacagagccatcccatcctgtg
accaagcgctttggtaccgtattgaaacaacgggtgcaggttctgcaggctgagttacaa
aagtacacctctcgtcgcattcaccagactcctctatactcagcaaccactccattcaaa
ggggatttccaccggcttgctcgtcggctttgtggtaaatctgttgggcttgttcttggc
ggcggaggggcaaggggaattgctcatgtaggggtgatcaaggctctggaagaagcggga
gtccccattgatataattggaggtacatccataggtgcttttattggcgcactctatgcg
agagatgccgatgttgtgcccctctatggtcgtgcaaagaaatttgccggccgcatggga
agcatatggcgattcgcccttgacctcacctatccatcggcgtcatacacaaccgggcat
gaatttaatcgtggcattttcaaagcttttggcgacagccaaatcgaagacttctggctg
gaattctactgcaataccaccaatatcagcaaatcgtgcaacgaattccacacgtcgggc
tatgtatggcgttacgtgcgagcgtcgatgtcactagctggtctcctcccacccatgtgc
gacgaaggcaacatgctcctcgacggcggttacgtcgacaacctccctgtttcccgaatg
aaatcgcttggcgcagacgtcattttcgccattgacgtcggctctatcgacgataatacc
ccacaggcttacggtgactccctttccggcttctgggccctggtcaaccgctggaaccct
ttctcctccctcgctaatccgcccacccttgccgaaatccaagcccgtcttgcctacgtg
tcctccttcagtgcgttggagaccgcgaaaaacactccaggttgtttgtacatgcgaccc
ccaattgatgcatttggaacgctagattttgccaagttcgacgagatttataagatcgga
tatgcgtatggacgcgagtttttggagcggttgaagaatgagggtggccttccgattcca
gacgaaactgaggagaaaaagaatttaaggaggaccatggcgcctaggagggccagcatc
tga

DBGET integrated database retrieval system