KEGG   Paracoccidioides lutzii Pb01: PAAG_01591Help
Entry
PAAG_01591        CDS       T02230                                 

Definition
(RefSeq) hypothetical protein
  KO
K05759  
profilin
Organism
pbl  Paracoccidioides lutzii Pb01
Brite
Cytoskeleton proteins [BR:pbl04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     PAAG_01591
Exosome [BR:pbl04147]
 Exosomal proteins
  Proteins found in most exosomes
   PAAG_01591
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 129 aa AA seqDB search
MPCPGIDKAAIYSTDPQYANSPCASSQGFTAQPNEIAFILSSFAETKDDEPKEVQTNGFY
YAGEKYFFVRSDKDPDCLIGRKEKEGIVIYKTASALFIAHHPPSAQTPTVNEYVDGWARY
LINAEKAQG
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgccctgtccgggaatcgacaaggcggctatctatagtacggatccacagtacgccaac
tcgccatgtgctagctctcagggtttcacggcccagccgaacgaaatcgccttcatcctg
agctctttcgcagagaccaaggatgatgaaccaaaggaagtacaaacaaatggcttctac
tatgccggcgagaaatatttctttgtaagatcggacaaggacccggattgcctcattggc
cgaaaggaaaaggagggtatcgttatctacaaaaccgcctctgccctctttattgcccac
cacccaccgagtgctcagactccaactgtcaacgagtacgtggatggatgggccagatat
ttgatcaacgctgagaaagctcagggttga

DBGET integrated database retrieval system