KEGG   Paracoccidioides brasiliensis: PAAG_01591Help
Entry
PAAG_01591        CDS       T02230                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
pbl  Paracoccidioides brasiliensis
Brite
Exosome [BR:pbl04147]
 Exosomal proteins
  Proteins found in most exosomes
   PAAG_01591
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 148 aa AA seqDB search
MTDPSVNKPVGWPDYHNGLLQCPGIDKAAIYSTDPQYANSPCASSQGFTAQPNEIAFILS
SFAETKDDEPKEVQTNGFYYAGEKYFFVRSDKDPDCLIGRKEKEGIVIYKTASALFIAHH
PPSAQTPTVNEYVDGWARYLINAEKAQG
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgacagacccatctgtcaataagcctgttggttggccagactatcacaatggcctattg
cagtgtccgggaatcgacaaggcggctatctatagtacggatccacagtacgccaactcg
ccatgtgctagctctcagggtttcacggcccagccgaacgaaatcgccttcatcctgagc
tctttcgcagagaccaaggatgatgaaccaaaggaagtacaaacaaatggcttctactat
gccggcgagaaatatttctttgtaagatcggacaaggacccggattgcctcattggccga
aaggaaaaggagggtatcgttatctacaaaaccgcctctgccctctttattgcccaccac
ccaccgagtgctcagactccaactgtcaacgagtacgtggatggatgggccagatatttg
atcaacgctgagaaagctcagggttga

DBGET integrated database retrieval system