KEGG   Paracoccidioides brasiliensis: PAAG_01808Help
Entry
PAAG_01808        CDS       T02230                                 

Definition
MAP kinase kinase MKK1/SSP32
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    PAAG_01808
Enzymes [BR:pbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     PAAG_01808
Protein kinases [BR:pbl01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   PAAG_01808
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 502 aa AA seqDB search
MSNMSTPAPLLKIPTPGSNRKQPPRLTLGIPPSPSMKPVNSNGLVSASDASQSRPVRPAP
PQLRLATPMGSKATPQEAGPLNSARPSIQTFGASSAITSNSDHSNHSRSGSFTTYDGRNS
GPTSATSSNYSTLSFAIGLRQPPGGTPDPTSAISSVYSDRGDGGLTMERDNNMNGLLPDL
EKLSLEKGRPLDVEDLDDEGWLAASSQKKIIELDSLGEGAGGAVTRCMLKGGKTVFALKI
ITTDPNPDVKKQIVRELNFNKDCASEHICRYYGAFMDKSTSTISIAMEFCEGGSLDSVYR
EVKKLGGRTGEKVLGKVAEGVLNGLTYLHGRKIIHRDIKPSNILLCRNGQVKLCDFGVSG
EFGTKGDANTFIGTSYYMAPERITGQSYTITSDVWSLGVTLLEVAQHRFPFPADGTEMNP
RAGLIDLLTYIVRQPIPQLKDEPENGIKWSENFKYFIECCLEKEPPRRATPWRMSEHPWM
LEMKTKKVNMAHFLKQVWGWQD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacatgtcgactccggctccccttttaaaaataccaactccgggtagcaaccgg
aaacaaccacctcgtctcaccctcgggatcccaccttcgcccagtatgaaacctgtgaat
tcaaatggtctcgtctctgcctccgatgcctctcaatcccgacctgtccgtccagcacca
ccccaactgagattagccactcctatggggagtaaagctactcctcaagaggcaggtccg
ctgaacagtgcacggccatccatccagacttttggggcctcgtccgcaatcacaagtaat
agtgaccacagcaaccattcgagatcgggaagcttcaccacatacgacggcaggaacagt
gggcccacatcagctacttcttcgaactattccacactatcttttgctattggcttgaga
caacctcctggcggaaccccggatccgacttccgctattagttccgtgtattccgatcga
ggggatggcggtttaactatggaaagagataacaacatgaatggtttgttgccggatttg
gagaaactgagtttggaaaagggacggccgttggacgtagaggatttggatgatgaaggt
tggctggccgctagctcacagaaaaagattattgaacttgatagccttggtgaaggggct
ggtggtgccgtcacccgttgcatgttaaaaggagggaaaactgtatttgctctaaagatt
atcaccacagatcctaacccagacgtcaagaaacagattgtccgagagctcaatttcaat
aaagattgtgcatcggagcatatctgccgatattatggtgcgttcatggacaagtcgacc
agcactatatcaattgctatggaattttgcgaaggaggcagccttgatagcgtctatagg
gaagtgaagaagctcggaggacggacgggagagaaggtcttgggtaaggtagcggaaggc
gtattaaatggtctaacctacctacatggacggaaaattatccatcgagatatcaaacct
tcaaacatcctcctgtgtcgcaatggccaagtcaaactttgtgattttggggtcagtggt
gaattcggcacaaagggagatgcaaacacttttattggcacttcctactacatggcccct
gaaagaataacaggacaatcttacacaatcacatctgatgtttggtcccttggagtcaca
cttttggaagtagcgcaacaccgtttcccgttccctgcagacggaacggaaatgaacccg
cgagcagggctgatagacctcctaacctatattgtacgccagccgattccccagttaaag
gacgagcctgaaaatggcataaaatggagtgaaaatttcaaatactttattgagtgctgt
ttggaaaaggagccaccgagaagggcaacgccctggcgaatgtctgaacatccgtggatg
cttgaaatgaagactaagaaggtcaatatggcacacttcttgaagcaagtgtggggctgg
caggattag

DBGET integrated database retrieval system