KEGG   Paracoccidioides lutzii Pb01: PAAG_01969Help
Entry
PAAG_01969        CDS       T02230                                 

Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00220  Arginine biosynthesis
pbl00330  Arginine and proline metabolism
pbl01100  Metabolic pathways
pbl01110  Biosynthesis of secondary metabolites
pbl01130  Biosynthesis of antibiotics
pbl01230  Biosynthesis of amino acids
Module
pbl_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    PAAG_01969
   00330 Arginine and proline metabolism
    PAAG_01969
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PAAG_01969
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 9099527
NCBI-ProteinID: XP_015701509
UniProt: C1GTX4
Position
Unknown
AA seq 360 aa AA seqDB search
MTQENTNNVISPSMIKHKFLSKPKEVGVVAVGFSGGQSKPGVDDGPTALIETGLLEQLQE
DLGYTVNYDNKVHNYGDIVPVSDPDFRGMKRPLSVSAVTEKLSQQVYEHARDGKFVLTLG
GDHSIAIGTVSGTAKAMRERLGREIALIWVDAHADINTPETSGSGNIHGMPVAFLTGLAR
EERSDIFGWLGRDHFVSTRKLVYIGLRDVDRGEKKILRENGIRAFSMHDIDKHVSPPNPT
IHIYSYILFCFDALANHDVRHGIGRVVEMALAHIGADTPIHLSFDVDALDPQWAPSTGTP
VRGGLTLREGDFIAECVHETGNLVAMDLVEVNPSLEIMGANETIRAGCSLVRCALGDTLL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacacaggaaaatacgaacaatgtgatctcgccgtctatgatcaaacacaagttcctc
tccaaacccaaggaagtgggggtagtggccgttggcttttccggaggccagagcaaacca
ggagtcgatgacggccccacagctctcatcgaaacaggcctactcgagcaactccaagaa
gacctaggctacaccgtcaactacgacaacaaagtccacaactacggtgacatcgtccct
gtctccgaccccgacttccgaggcatgaaaaggcccctctctgtcagcgccgtgacagag
aagctcagccagcaagtctacgagcacgcgcgagatggcaagtttgtcctgacgttgggc
ggcgaccattccatcgctatcgggaccgtgtcgggaactgcgaaggcgatgcgggagagg
ctggggagggagattgcgctgatctgggtggatgcgcatgctgatattaacacgccggag
acgagtgggagcgggaatatacacgggatgcctgtggcgtttctcacggggttggcgagg
gaggagaggtcggatatctttgggtggttggggagggatcactttgttagcactcggaag
ctggtgtatattggtttgcgcgatgtggatcgcggggagaagaagattctaagagagaat
gggattcgggcgtttagtatgcatgatattgataagcatgtttccccccccaaccctact
atacatatatattcttatatcctcttttgttttgacgctcttgctaaccatgatgtcaga
catggtattggacgtgttgtcgagatggctctggcgcatatcggagccgatacaccaatt
catctctcgtttgacgtggacgctcttgatccccaatgggctcctagcacgggtactccc
gtccgaggcgggctgactctccgtgaaggcgacttcatcgctgaatgcgttcacgaaacc
gggaacctggttgcgatggacttggtggaagtgaacccaagcctggaaatcatgggtgcc
aatgagaccatccgggcgggctgctcgttagtccgctgtgcattgggggatacacttctc
taa

DBGET integrated database retrieval system