KEGG   Paracoccidioides brasiliensis: PAAG_02000Help
Entry
PAAG_02000        CDS       T02230                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.1.2.15]
Organism
pbl  Paracoccidioides brasiliensis
Brite
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PAAG_02000
Peptidases [BR:pbl01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PAAG_02000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 641 aa AA seqDB search
MPDKPATVAAYAAGASLAAITLFYVFGPNFTIDNEESNTTTRKKGIVGLYNPSNDCFINS
VLQALAGLGDLRLYLIRELHRRQLEGPEIYNSLPDIESIPRGETPEKVRELQQASVTRAL
KEMLDSLNERPIYKKTISARTFILALESAFQTRISRNQQDAQEFLQIVAERLCDEYHAGV
KARERAAASSLKAGVANSILEAKPMGRSGIGDSDSELENGSPSLDTGAEALDTEFPFPFE
GKMESQIECESCHFEYKPNPTSFVNLTLQVPQKSSVTLSSCFDGLLKTEYIDDFRCGKCV
LLHALQIKEAARKKALSEREIKHWDHEISLIKHALEIDPETIPRGVSMPNTQNVPKRKIA
RHMRITSFPKIIAIHLSRSIFDRNSSSKNAAKVSFPERLPIGGILDQKWYKLLGIVCHKG
SHHSGHYESFRRNHLYAPFSTPDTFRSYSQSRSPSRTTSTAPSPSINPKHKTAAAQDLEA
SPLSMSDDTQSSSASSTSLPVPSLHTSSSHLLTSTHDTAPTQPSPTSPQSTPSSQEQQES
RDISITSPVTPRLKPSPSDPNAATSSRTSSLRRQSITKAAKLTGPGTGNPSRLRWKKRPS
DRWWRISDDKVKECKTSDVLGMQREVYLLFYEMERPEDDEQ
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacaaacctgcgacagttgcagcctatgctgccggcgcctccctagccgctatc
accctattttacgtcttcggccctaatttcacgattgacaacgaggaatcgaatactacc
acgagaaagaagggaattgtcggcctctataacccgtccaatgactgcttcatcaattct
gttctgcaagccctggctggcctgggcgacctccgtttatacctaattcgcgaactacat
cgacggcagctggaagggccagaaatatacaactctttaccggatatcgaaagtattccc
cgcggcgagacacctgagaaggtgcgcgagctacagcaggcatccgtcaccagagcgctg
aaagagatgctcgatagtctcaatgagcgacccatatataagaagacgatatcagcgcgg
acgtttatattggctttggagtctgcgtttcagacccggataagccggaatcagcaggat
gcacaggaattcttacagattgttgcggagcgcctgtgtgatgagtaccatgccggtgtt
aaggcgcgggagagggcagctgcatcctcactcaaagcgggtgtggcgaattcgatattg
gaagcaaagcctatgggtagatctggtattggggatagtgattccgaattagagaacgga
tcgccgtccttggacacgggagctgaggctttggatacggagtttccgtttccttttgaa
gggaagatggaatctcaaatagagtgcgaatcgtgccattttgaatataaaccaaacccg
acctcgttcgtcaatctgacgctccaagtgccccagaagagctctgttactctaagttcg
tgctttgacgggctgctcaaaacggagtacatcgatgatttccgatgcggcaagtgtgtc
ctcctccacgctctgcaaataaaagaagccgcaaggaagaaggctctatcagagagggaa
atcaaacactgggatcatgagatatcgctcataaaacatgccctggagattgaccccgaa
accatccccaggggcgtgagcatgcccaatacacagaacgttccgaaacgcaagatcgcg
agacatatgcgaatcacatccttccctaaaataatagccatacacctatcccgatcgata
tttgaccggaacagctcttcaaagaacgccgctaaggtctcgttcccggaacgactgcct
atcggcggcatcctcgaccagaaatggtataagttactaggaatagtatgccacaagggc
agccaccacagcggccattacgagtcttttcgacgcaatcacctctatgccccattttcc
accccagacactttccgctcctactcgcaaagtcgctctcctagtcggactacgtccacc
gcccccagccccagtatcaacccgaaacacaagacagctgctgcccaagacttagaggcc
agtcccctgagcatgtccgacgatacccaatcttcatcagcatccagcacctccctcccc
gtcccctcattacacacgtcctcttctcatcttttaaccagcacacatgacacagcaccc
acccagccatctccgacatcaccacagtcaactccatcatcgcaagagcaacaagaaagc
agggatatttccatcacttcaccagtcaccccacgactcaaaccatctccatcagatccc
aatgctgctacatcttcacgtacatcttctttaagacgtcagtccatcaccaaggcagca
aaacttacagggccaggaacaggcaatccatcgcggttacgatggaaaaaacggcccagt
gaccgctggtggagaatcagcgatgataaggttaaggagtgcaagactagtgatgtgctg
gggatgcaaagggaggtttacttgctcttttacgagatggagagaccggaggatgatgag
cagtag

DBGET integrated database retrieval system