KEGG   Paracoccidioides brasiliensis: PAAG_02129Help
Entry
PAAG_02129        CDS       T02230                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PAAG_02129
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     PAAG_02129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 999 aa AA seqDB search
MTFKPFRPPLIRKLPTTASPSTTTTSSSNADNSIGDSYPQSKRRRISPETVDLTINDNED
VGYDNRQRDAKSGSVRVVHKPSSKITDTERKPLIARWNPPVEVEVDDSGAYARSGGMETY
YNVLWRKPTAKKHKTWDGDGILAVRGGYAYLQDVSGRDLGRIKFNSPLLPGSTLSVGGKD
VEVDSVMSKKEYMSGRALLGIAELLPASISADDGTEIRKDPVRMSRISSATSTNGTIRLP
PKTKIKREHGDDGGAKKLLNSAVPKSSAVKSAFKNPMKESTVLVQKPNGNPIPRHNPTLP
GAVVMRRPESVPKGKEIVDVVLDPLLGKHLREHQREGVRFLYECVMGMRSFNGEGAILAD
EMGLGKTLQTIALIWTLLKQNPIYEAPPVIKKALIVCPVTLIDNWKKEFRKWLGNERIGV
FVADAKRTRLTDFTMGQSYSVMIIGYERLRTVQEELSKGSGIDIVIADEGHRMRTVQNKS
AQAIQPLNTSKRVILSGTPIQNDLTEFFAMVDFVNPGILGTFKMFMKQFEGPIVKSQQPG
ALKRDIEKGKARSEELASLTSLFILRRTADLLSKYLPPKTEYVLFCNPTSSQANIYRHVL
SSPVFQCALGNSDSALQLITILKKLCNSPSLLNPKSSDEDSTSTLSSLVASLPSSITRRL
TPASSGKIRVLDQLLHNIRHTTSEKVVLISNYTSTLDLLGKLLTSLSLSFLRLDGSTPAA
KRQALVDDFNRSSSTSVFAFLLSAKAGGTGLNLIGASRLVLFDVDWNPATDMQAMARIHR
DGQKRHCRIYRFLLKGALEEKIWQRQVTKIGLADSVMDQKSGVLQFSREELRDLFRLDEG
ATCQTHDLLGCECDGRGGQENFSHPNGSHIIDISESDHSENESTDSDEAANGFTKLIKAS
QLQTLSSGGAVTKGRGKISNKSRKGKSKIPSLMQYTHVDTSHLRSPSPHQTSGNFGADKA
NIEAHIDDDVLLSLLKEEGNGVSFVFKKHGSSGTPESSM
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcaaacctttccggcctccacttattaggaagcttccgactactgcctcccct
tcaacgacaacgacgtcttcgtcaaatgcagacaattcaattggagactcgtacccccaa
agtaaacgccgcagaatcagcccagaaaccgttgacctcacaattaatgataatgaggat
gttggctatgataatcggcaacgtgatgctaaatcaggatcggttcgggtggtacacaag
ccaagctcaaagataactgatacagagcggaaaccgcttatcgcaagatggaatccacca
gtggaagtggaagttgatgatagcggtgcttatgcaaggagtggtgggatggagacgtat
tacaatgtcctttggcgtaagcccactgctaaaaaacacaagacatgggatggcgatggg
atattagccgtccgcggtggttatgcgtatctccaggatgtatctgggagggatttaggc
aggattaagtttaattctccactactgcccggatcaacattgtcggttggtggaaaagat
gtcgaggttgattctgtcatgtcaaagaaggagtatatgtctggtcgagcattactggga
attgctgaacttttacccgcgagtatatctgccgacgacggtaccgaaatccggaaagat
ccagtacggatgtcccgcatttcttctgctacgtcaacgaatgggacgattagactgcca
cccaagaccaaaattaaacgcgaacacggagacgacgggggagcaaagaaactccttaac
tctgctgtgccaaaaagctctgcggtgaagagtgctttcaaaaatcccatgaaagaaagc
actgtactcgtacagaaaccgaatggcaatcccattccacggcataaccccacgctccct
ggcgcggtggtcatgagacggccagaatcagtaccgaaaggtaaagaaattgtcgacgtc
gtccttgatccccttttgggcaagcatcttcgggaacatcagcgcgagggtgttaggttt
ctttacgagtgtgtaatgggaatgcgctctttcaatggtgaaggggctatcctcgcggat
gaaatgggtttaggcaaaactttgcagacgatagcgcttatatggaccttgttgaaacag
aacccaatatatgaggcacctccagttatcaaaaaggctctaatagtgtgccctgtgaca
ctgatcgataattggaaaaaggaatttcgcaagtggctcgggaatgaacgcattggggtg
tttgtagctgatgccaaaagaaccagacttacggatttcaccatgggccaaagttacagt
gtcatgattatcggctatgaaaggctccgaacagtgcaagaagagctctcgaaaggttct
ggtattgatatcgtcattgcggacgaaggtcatcgaatgaggactgtacaaaataagagt
gcgcaagcaatacagccgttgaatacctccaaacgagtcatcctttcaggaaccccaatc
cagaatgacttaactgagtttttcgcaatggttgacttcgtcaacccaggaattctaggg
acattcaaaatgttcatgaaacaatttgaagggccgattgtgaagagccaacagcctggt
gcgttgaaaagggacatcgagaaaggaaaagcaagaagtgaagaattggcaagtcttaca
tccttattcattttacgacgcactgccgacctcctctcgaaatatctaccaccgaaaacc
gaatacgttctcttctgtaaccctacctcctcccaagcaaatatctatcgccatgttctc
agctcacctgtctttcaatgcgctttgggaaattctgacagtgctttacaactcatcacc
attctcaaaaaactatgcaatagcccttccctcctgaaccccaaaagctccgatgaagat
tctacctccacacttagttccctggttgccagtctcccctccagtattactcgaagactc
acacccgcctcgagtggtaaaatacgagtccttgatcaactactccataatatacgtcat
acaacttccgagaaagttgtgctaatctcgaactacacatccactctggatctcttggga
aaacttcttacttccctatccctatcatttcttcgccttgatggctccaccccggccgca
aaacgccaggcactggtcgacgatttcaatcgatcatcctcaacttcagtttttgcattc
cttctatcagccaaagctggaggtacaggtctcaatcttatcggagccagccggctagtt
ctctttgacgttgactggaacccagccacggatatgcaggccatggcacggatacatcgt
gatggtcagaagcgacactgtcgaatttatcgatttctgctaaagggcgcactggaggag
aaaatttggcagagacaggtcaccaagatagggttggctgacagcgtgatggatcaaaaa
agtggcgttttgcaattttcccgtgaggagttgagggatttatttcgacttgatgaagga
gcaacgtgccaaacacacgatctcctcggttgcgagtgtgatggtagaggggggcaagag
aatttctcgcatcccaatgggagccatataattgatatttctgaatctgaccatagcgaa
aatgaatcgacagactcagatgaagctgccaacggcttcacgaagttgataaaagcctct
cagctccaaaccctatcttcaggaggggcagtgacgaaagggcgtgggaagatttcaaac
aaatctaggaagggaaaatccaaaattccttcactgatgcaatacacgcacgttgatacg
tctcaccttcgctctccatcgcctcatcaaacctcgggaaattttggcgcagacaaagct
aacatcgaggctcatatcgacgacgatgttcttctctccttgctgaaagaggaaggaaat
ggagtaagttttgtgttcaaaaagcatgggtcttctgggacccctgagagctccatgtga

DBGET integrated database retrieval system