KEGG   Paracoccidioides brasiliensis: PAAG_02229Help
Entry
PAAG_02229        CDS       T02230                                 

Definition
guanidinobutyrase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PAAG_02229
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PAAG_02229
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 311 aa AA seqDB search
MPITETYHDHEKQQWGFAGISTFTHLQHVRCLLEPDDPYDIAILGTPFDNAVSYRPGARA
IRAASARQIPANSYNIHAGINQYLNWARILNCGDIPANPFDNGLAKRQIYEAFLKLATRD
VPNPIRGISIILPALRASSKIYGKLITVLHFDAHPDTGNPIWYSAFWTSDHSRFNHGSFF
HTASLEGLISNTSSAHAGLRTRLTGLDDGDYSNPGPEQGFLRIHADNIDDIGAHVWTLTC
WILLSPLELARRTLGGRVGCGIEKLNLVDADIVEVSPIYDNVAEGTALAVAQVAFEIMSS
MVKLGAKEDVG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcccattacggagacatatcatgaccatgaaaaacaacagtggggatttgccggtatt
tccaccttcacccatctccagcatgttagatgtctccttgagcctgatgatccatacgac
atagccatcctcggcacccccttcgataacgcagtctcctaccgcccaggggcccgcgca
atcagggctgcaagtgcccgtcagatccccgcaaacagctacaacatccatgccggcata
aatcaatatctaaactgggcccgcattctcaactgtggcgatatccccgccaaccctttt
gacaatggcctcgcaaagcggcagatatacgaagccttcctgaaactcgcgacgcgtgac
gttccaaaccccatccggggtatttccatcatcctcccagcgctgcgtgcctcgtccaaa
atctacggaaaactcatcacagttcttcacttcgatgcacaccccgacaccgggaaccca
atatggtactccgcgttctggacctcggaccattctcggttcaaccacggcagcttcttc
cacacggccagtctcgagggattgatttccaacaccagctctgcacacgctggtctccgc
acgcgcctgaccggtctggatgatggtgattattcaaacccgggacccgagcagggattc
ctgcgcatccatgctgataatatcgatgatatcggcgcccatgtctggacattgacgtgc
tggatccttctatcacccctggaactggcacgccggacccttggggggcgggttggatgc
gggattgagaagttgaatcttgttgatgctgatattgtggaagtctcacctatctatgat
aatgttgcggaggggactgcgcttgcggttgcgcaggttgcgtttgaaattatgtcaagt
atggttaagttgggggctaaggaggatgtggggtag

DBGET integrated database retrieval system