KEGG   Paracoccidioides brasiliensis: PAAG_02254Help
Entry
PAAG_02254        CDS       T02230                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
pbl  Paracoccidioides brasiliensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 249 aa AA seqDB search
MAGSPDVPAKAKAFVPLENNAEVMSHLIHQLGVSDAIGFTDVYSIIDPDVIAFVPRPSHA
ILLVFPVTPAYESWRIAEDKDIPAYGGSGPNEPVTWFKQTIRNACGLIGLLHAVSNGPAR
DHITPGSDLERLLRDAEPLRPGPRADLLYASKALENAHADAAKKGDTSAPDANTKTDLHF
VCFVKGSDGHLWELDGRRKGPLDRGVLDEDEDVLSENALKLGAWQFLKREIEAEGDLRFS
LVSLGPVFD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcagtcctgatgtccccgccaaagccaaggcctttgttcctctcgaaaacaat
gcagaagttatgtcgcacctcatccaccaactaggtgtctcagatgctattggcttcact
gacgtctacagcatcattgacccggatgtcatcgccttcgtaccccgcccctcccacgcc
atcctcctcgttttccccgtaactccagcatacgaaagctggcgcatagcagaagacaaa
gacatccccgcatatggaggctccggccccaacgaacccgtaacttggttcaagcaaaca
atccgaaatgcctgcgggctgatcggactcctgcacgctgttagcaacggtcctgctagg
gaccatatcacccctggctcagatctagagaggttgctgcgggacgcggagccactgagg
cctggacctagggcagatttactatatgccagcaaggcgttggagaatgctcacgctgat
gcagcgaagaaaggggatacttccgcaccagatgcgaacaccaaaaccgatttgcatttt
gtatgctttgtgaaggggagtgatgggcatttgtgggagttggatgggcggagaaagggg
cctttggatcgtggggtgttggatgaggatgaggacgtcttgagcgagaatgctctaaag
cttggtgcttggcagttcttgaagagggaaatagaggccgagggcgacctaaggtttagt
ttggttagtctggggccggtttttgactaa

DBGET integrated database retrieval system