KEGG   Paracoccidioides brasiliensis: PAAG_02263Help
Entry
PAAG_02263        CDS       T02230                                 

Definition
histone acetyltransferase ESA1
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
pbl  Paracoccidioides brasiliensis
Brite
Enzymes [BR:pbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PAAG_02263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 517 aa AA seqDB search
MGVSDASQEAPGTPDPVEKGFATLNTIRIGMKAFVEKDGEHRKAEILSMRQRKGGSSFYV
HYVDFNKRLDEWIPASRIDLTQEVEWPQPDKPEKKKVTGAAAPKAQPKNSQKRARANSRE
VSTAPELLAGKNLNISKASRPSKAGGKENSDDVMPSNLSLLGSEAVSSVNTPRADGEPED
VEMVDAVDAEAKQTIKQEEEKIAGDLTRGEEIEKLRTHGSMTQNPTEIHRVRNLTHIQMG
KYEIEPWYFSPYPAHFTDADMVYIDEFCLSYFDQKRSFERHRSKCTLVHPPGNEIYRDDN
VSFFEVDGRRQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTTRDEHGCHLVGYFSKE
KESAEGYNVACILTLPQYQRRGFGRLLIAFSYELSKRESKLGSPEKPLSDLGLLGYRQYW
RETLVDILMEPGRESISESELANLSAMTEKDVHETLVVLNLLRYNKGNWVIVLTDAVIEQ
HRKRLEKEKFKGARKIDPARLQWKPPVFTASSRTWNW
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtgagtgatgcctcgcaagaggccccaggcaccccagatcctgtggaaaagggt
tttgccacactcaacaccatcaggatcggtatgaaggcgtttgtcgaaaaggatggggag
catcggaaagcagagattttgtcgatgaggcagcggaagggggggtcgagcttttacgtt
cattatgtcgatttcaataagcgtcttgatgaatggataccggcatccaggattgacctt
acccaggaagtcgaatggccacagccagacaaaccagagaagaaaaaggttactggtgca
gctgctccaaaggcacagccgaagaactcccaaaaacgggcgcgagcaaatagtcgcgag
gtttcaacagcgcctgagcttcttgctggtaagaatcttaatatcagcaaggcatcccgc
ccctccaaagcaggcgggaaagagaatagtgatgacgtaatgccttcgaacctctcgctg
ctgggcagcgaagctgtttcgtcggttaatactccaagggcagacggggagcctgaagat
gttgaaatggtcgatgccgttgatgcagaggcaaaacaaactataaaacaggaagaggaa
aagatcgccggagatctcacccgaggagaagagatcgaaaagctgcgaacacatggaagc
atgacgcagaatccaactgagatacatcgcgtgcgaaacttgactcatattcaaatgggc
aaatacgagattgaaccgtggtacttttcaccctatccagcacacttcaccgatgcggac
atggtgtatatcgatgagttttgccttagctatttcgaccaaaagcgctcctttgaaaga
caccgttccaaatgcacccttgttcaccctccaggcaatgaaatctaccgtgatgataat
gtctcattcttcgaagtcgacggacgccgccagcggacctggtgccggaatctgtgtctg
ctaagcaagctattcctggaccacaaaactctctactacgacgtggacccgttcctcttc
tactgcatgaccacaagagacgagcatggctgccatttagtcggatacttctccaaagag
aaagaatctgcagaaggctataatgtcgcttgcattctcacattacctcagtaccagcgt
cgaggcttcggtcgacttctcatcgctttcagctacgagctcagcaaacgagaaagcaag
ctgggttcccccgaaaaaccactcagcgacctggggctcctgggatatcggcaatattgg
agggaaacccttgtagatattctcatggagccgggtcgggagtccattagcgagagcgaa
cttgcaaatcttagcgcgatgactgagaaagatgtccacgagacgctagtagtgctaaat
ctcttgcgatacaataagggaaactgggtcatcgtgctcacagacgcggttatcgagcaa
catagaaagcgcctggagaaagagaaattcaagggcgctcgcaaaatcgatcctgccagg
ttacaatggaaacctcccgtttttactgcgtcaagccggacgtggaattggtag

DBGET integrated database retrieval system