KEGG   Paracoccidioides brasiliensis: PAAG_02496Help
Entry
PAAG_02496        CDS       T02230                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PAAG_02496
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PAAG_02496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 623 aa AA seqDB search
MALLKISLFGLSLSLTVYASFSANLNYGSPSHNHPDLGIAINKVQKRNVHTSPFKPEQLY
FTHSVASGDPYPDSVILWTRVSPTTESSDSNVTVSGTTPLYDHDNEKYVSVSTAPVCVKY
KVAMDLKMKRVVTGGEVWTSSDVDYTVKVEATGLRPYTTYYYQFTVCDSKNSSPVGRTKT
TPRRRDKVKKDIGLAVFSCSNYPQGFFNAYGNSARKDNVDYVLHLGDYIYEYKEGGYGWG
WSINRIPQPPDRDIKTLLDYRKRYASYRTDADLVYSHQHFPWITVWDDHEVEDNVWKAGS
STMNNTEDSFIQAGGISIDQVKANAVRVHFEWMPIRQVDMDDTLRIWRNFEIGDLFSLIM
LDTRVYDRSITDLSWNKHYIDLIRDEQSRSLMGPRQETWFYRQLIESAKRNTKWRIVGQQ
LLISDIFYGKNEQKLYNADAWDGYRANKNRTLSTILDHKIKNTIFLAGDTHAAYVSDLVY
TGHGKYDPKSGSGAIGVELGATGVTSPGPVGQNGTFDRGAKESQRFVENNTPLQWQDSYY
RGYYELSINYNRVHANFFGVPDIRTRNGKEIKLATFEILDGKNKLTRNENGEPVVGKAVG
GALKNGKVYPDAAVIVDTMKGKK
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atggctcttctcaagattagtctgtttgggctttcgctgagtttaactgtctatgcctca
ttctctgccaatttgaactacggctctccatcccacaaccatcccgatcttggaattgcc
attaacaaggtgcagaagcggaatgttcacacctccccattcaaaccagagcagctatat
ttcacccatagtgtggcatctggggacccatacccggattccgtgatcctctggacccgc
gtctcccccacaacggagagcagtgactccaacgtgacggtcagcggtaccacgccgctg
tatgaccatgacaatgagaaatatgtttccgtttctactgcacccgtctgtgtgaagtat
aaggtcgctatggatctgaagatgaagagagtggttactggtggagaagtgtggacttca
tctgatgttgactatacggtgaaggttgaagcaactggtctgaggccgtacacgacgtac
tattatcaatttactgtctgcgactccaaaaactcttctcctgtgggacgtaccaaaacc
acccccagaaggcgggacaaggtgaaaaaggatattggccttgctgtcttctcttgttca
aactaccctcagggattctttaatgcttacggaaattctgctcgtaaggataatgtagac
tacgttcttcatcttggtgattatatctatgagtacaaagagggtggctacggatggggc
tggtccataaaccgcattccgcagccgccggatcgcgatatcaaaactctacttgactat
cgtaagagatacgccagctaccgcaccgacgctgatctggtttattcgcaccaacacttc
ccgtggatcactgtttgggatgaccatgaggtggaggataatgtgtggaaggccggctcg
tccactatgaacaatacagaagactcattcatccaagcgggtggaatttccattgatcaa
gtcaaagcgaatgcggtccgtgtccacttcgagtggatgccaatccgccaggtcgatatg
gacgacaccctccgtatctggcgcaattttgagattggagatctattcagccttatcatg
ctcgacactcgtgtctatgaccgctccattaccgacctgtcctggaataaacactacatc
gatctcatccgtgatgagcagtcccgctccctcatgggtccccgtcaagagacctggttc
taccgccagctcatcgagtctgccaaacgtaacactaaatggagaatcgtaggccagcaa
cttctcatctccgacatcttctatggcaagaatgaacaaaagctgtacaacgcagatgcc
tgggacgggtatcgcgccaacaaaaaccgtaccctctccaccatccttgaccacaagatc
aaaaacaccatcttccttgcaggcgatacccacgccgcctatgtctctgatctcgtatac
accggtcacggcaagtatgaccccaaatctggatcaggagcaatcggcgtcgaactcgga
gccacgggggttacctccccgggtcctgttggccaaaatggtaccttcgaccgaggagca
aaggagtctcagcggtttgtcgagaacaacactcccttgcaatggcaagattcgtactat
cgtggctactatgagctcagcattaactacaaccgcgtccatgcgaacttcttcggtgtc
cctgatatccgcacgcggaatggaaaggagatcaagcttgcgacctttgagattctggat
ggtaaaaataaactgacgagaaatgagaatggggagccggtggttgggaaggctgttggg
ggagcgttgaagaacggtaaagtttaccctgatgctgcggtgattgtggatactatgaag
ggcaagaaatag

DBGET integrated database retrieval system