KEGG   Paracoccidioides brasiliensis: PAAG_02533Help
Entry
PAAG_02533        CDS       T02230                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
pbl  Paracoccidioides brasiliensis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PAAG_02533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1667 aa AA seqDB search
MDGGDELDSLRGLFQDLSSLSRAALPDIDRLVFELEATIQDFRKLLEKPTKKNESRQTVL
SGKIKVHDVEYSVNKEFQQDVLQVADALDLDEIEAADYYLRAQDDARKLDRSPVMSTIIR
FHERRSFLLECLRLVFYESFEVEREGTQAIMQDYVAKILEIQNGPLRNASLFARKCMDSM
VDIEKWLIRLGELAQKASIVGQAQESDLEIIEFQRGSLGKEHESLGAILCYLFKGTFTSS
EDFRLLLDRLRKLDKFDMILVHYIPAIVSSSSQYGSPEGSGSLRDARSLHQAVTSSREPQ
DWLLSKFHATTTALWLAEYSGWYYETSPASPLEGISPERETADLTKLFVTVLDDGALEFM
LEVCAGVSQNQWRDPSRAELVNLLLKDSVPLAIEQDSSSYFHDLLMEHFEIFVESLIANM
PDAIRTLKSEEDIQRLDQITALREGLTTNIHRGPIETRMHFEALLMIMAFAFEHRVDAAQ
EFWADSEGNLYGFLQWASKRQTVPRASAFCEMLCSISEGEENSLSAHKFLLDEEKISPTK
FKRSASMGWTQMIEELQLYATKATERPSAAPPSVFRIRKLEPADIDEPESPVMLTSYLRL
ISHLCRQNSTIRQWILEHPTLNLINVLLTLCDAPIPSHLRSSIFVTFRCLMVDRISVHGN
EMWISLDHWISGSGSQTSGFAKISLVTSSPGWNDRHSFRKIAETFDQTYSFVDLLDTLVS
PPIDLIDSRLSLPFPEALGSSYRMPGIEPYIDFVMGQAFASRSIDLHEPQARLLQLSCFN
FVATCLENFNENLISIINQPSIPLDSGLRSSSLNAYIRLHPFARVMEWIFNEDVLKTMFA
TAHQNIDEVARAASDSILLRCLVRTIDVMNLVMDHQSTYFDVVRPLIKYQTRQTANTVAN
SSLASFEDSVMDNLRLVTDLCLYCGTGHPLLTLASLNLLEKLSSSRKLNRATSSTISRWQ
ASNQIVELLNNDVEAERIARSLAPQMKPDLREIENGPTSSGYLIKLGLVNLLDRCLSMNP
EKPNMAHLLLGFSCLGNTLDIAVEGLFQDKMSLFHAMVDFVQNYPDGENGTILTWMIYLK
ESCFRVLRHLWSSKLSSTLVLPELHQRQLLVTLFITQPQVGPETLWDNFQTTDPEFWYSS
SPDSVSEFLSFRSLLFDYAVTEVRSAARHGSPSLQKDTLSTLLGSSVDENNRTFTHPSFF
DLFDFVDLDIEAVQPPSNLKFFDGSNLDLCAKIQHDGLVIYDLPSVKELLELTKQELLNA
GIATSNDDEQLLAEQNNILLFLRATNQSRKIHHSRYLAVRSWAELATTIIVTCEMEAAQR
PMLILHILQLILPKLESSVMDNVAEAIELGRLAESLIDKLGTGHPPETPNKGTDIIDERL
YHLFQTCIRGIPLATENSALRECLYNICSQYLSRITRNMSDHNRFGSHSQQAVKASGSSL
VEVLCDDAYSGQEACRISALLLLNLLAVLDRQLSSSLLIELVAQSNYLAMFVDVVGAIPS
EFRKASASETSRLSVYYDTHLCLLQQLAQSRVGAERVLDAGLFQAVKESQLFATDPDIGI
EIDNPDALQKYYDLLLSVMRVIVSAVFARGLHNQQVRDQTRIFLSKNRQSIVGIFKRYTK
ICGLDEKKPRETVEDLVKSYIALIEAVGFLEFEDEQSIDKMGPKSFS
NT seq 5004 nt NT seq  +upstreamnt  +downstreamnt
atggatggcggcgatgaactagatagcctgaggggccttttccaggacctttctagcctc
tccagagctgcccttccagacatcgataggctagtttttgaactagaggcaaccattcaa
gacttcagaaagctcctcgaaaagcccacaaagaaaaacgaaagccgccaaaccgttctc
tccgggaaaattaaggtccacgatgtcgagtactcggtaaataaggaattccaacaggac
gtcttgcaggtggcagacgccttggatttggacgagatcgaagcagccgattactattta
cgagcgcaagacgacgcaaggaaattagaccgctctcctgttatgagtacaattatacgt
tttcatgaacgacgatctttcctcctggaatgcctacgtttagtcttctatgagtcgttc
gaggtcgagagagaaggcacccaagctatcatgcaggattatgttgcgaaaattcttgaa
atccaaaatggccccttacgaaatgcgtctcttttcgcaagaaagtgtatggattccatg
gttgatatcgaaaaatggctgatacgcctgggcgagttagctcaaaaagcttcaattgtg
ggacaagctcaagaatcagatctcgaaattatagaattccaacgcggcagccttggaaag
gagcatgaatctcttggagcgatactgtgctaccttttcaaaggcactttcaccagctcg
gaagatttccgcctactcctagacagacttaggaaactcgataagttcgacatgatatta
gtccattatataccagcaatagtctcctcgtcatctcagtatggctctccggaaggttct
ggatctcttcgtgatgcaagatctctccatcaggctgttacatcttccagagaaccccag
gactggcttttatcaaaatttcatgctactacaacagctctatggctggccgaatactcg
ggttggtattatgaaacttcccctgcgtctcctcttgaaggtatcagtcctgaaagggag
accgctgatctcaccaagttgtttgtcaccgtcctcgatgatggggccctcgaatttatg
cttgaggtctgtgccggcgtcagtcagaaccagtggcgcgatccatcaagggcagagcta
gtgaacctactcctcaaagacagtgtgcccttggcgattgagcaggactcttcttcatat
tttcatgatttactcatggaacacttcgagatattcgtagaatctctcattgccaacatg
cctgatgcgatcaggacattgaaatcggaagaagatattcagcgactggatcaaattact
gctcttcgggagggcctgaccacaaatatacataggggccccattgaaactcgcatgcat
tttgaggctttgctcatgataatggcgttcgcgtttgagcatagagttgacgccgcacaa
gaattttgggcagattcggaaggaaatttatacggatttctccagtgggcgtcgaagcgc
cagactgttcctcgggctagtgccttctgtgaaatgctttgttctatctcagaaggggag
gaaaattccttgtcagctcacaagttcctcttagacgaagaaaaaatatcacccacgaaa
ttcaaaagatccgcatcgatgggctggactcaaatgatagaagagctccagctctatgcc
acaaaagccactgaacgtccttcagcagcaccgccatccgtttttcgtattcggaaactt
gaaccggcggatattgatgaacccgaaagtcctgtgatgcttacttcttacttgagactc
atcagccacctatgtaggcaaaactctacaattcgccaatggatcttggagcatccaaca
ctcaacctcattaacgttcttctaacgctgtgcgacgctcctattccaagccatctgaga
tccagcatatttgtcacctttcgctgtttaatggtggacaggatatccgttcatgggaat
gagatgtggatttctcttgaccattggatttctggttcaggatcccaaacttcaggtttt
gctaaaatatctcttgtgaccagttcacctggctggaacgatcgccattccttccggaaa
atagcagaaacattcgaccaaacatattcatttgttgacctcctggacacattggtatca
ccacctatcgatttgatcgattcgcgactctctcttccctttccagaagcattggggtcc
tcctaccgaatgcccggcatagagccctatatcgattttgtcatgggccaagcattcgct
agtagatccatcgaccttcacgagccacaagctcggcttttgcaactaagctgcttcaac
tttgtagccacctgccttgagaattttaacgagaacctcatttccatcataaatcagcct
tccattccgctagactccggcttgcgatcatcatccctgaatgcgtacattcgattgcat
ccattcgcgagggtgatggagtggatatttaacgaggatgttctcaagaccatgtttgct
acggcgcatcaaaacatcgatgaggtcgcaagggctgcatctgattccatactacttcga
tgcttggtccgaaccattgacgttatgaaccttgtgatggaccaccagtcgacctacttt
gatgtcgtacggccattgattaaatatcaaactagacaaactgcaaataccgtggctaat
tcgtctcttgcgtcgtttgaggatagtgtcatggacaatctccgcctggtcacagatttg
tgcctctactgcggtaccggccatccactgttaactctagcttctctcaaccttttggaa
aagctatccagctcccggaagctaaatagagccacatcgtccacaatatcgcgttggcag
gcatccaatcagatagtggaactattgaacaatgatgttgaggcagagcgcattgctcgc
tctcttgctcctcagatgaaacccgatttgcgagaaatagaaaacggtccaacatcttct
ggctatctcatcaaactagggcttgtaaatttacttgatcgctgtctcagtatgaatccc
gaaaagccaaatatggctcatctccttctgggattttcttgtctgggaaacacgcttgat
atagcagtcgagggattgttccaggacaagatgtcacttttccatgctatggtcgatttt
gtgcagaactaccctgatggggaaaatgggacgattttgacttggatgatttatctcaaa
gaatcgtgcttccgtgtgcttcgacatctctggtcatcgaagctctcttcaacactagtt
cttccagagctccatcagcgtcaactccttgttaccctgttcataactcaacctcaagtc
ggtccagaaaccctctgggataatttccaaactactgatccagaattttggtactcgagt
tcaccagactcggtatcagaatttcttagtttccgcagtcttctttttgactatgccgtg
accgaagttcgctctgcagcaaggcatggctccccttctctgcaaaaagataccctatct
actcttctaggaagttcggttgatgaaaataaccgaacttttacccacccttctttcttc
gacctctttgatttcgtcgatttggatattgaggccgttcaacctccctcaaatcttaag
tttttcgatggcagcaatctggatctatgcgcaaagatacagcacgatggtttagtaatc
tatgatctcccctccgtgaaggagcttcttgaactcaccaagcaagaattactcaacgct
ggaatagcgacatctaatgatgatgaacagctccttgctgaacaaaacaacatattgctc
tttcttcgtgcgactaatcaaagccgaaagattcatcacagccgctacttagctgttcga
tcttgggcagaacttgcgaccacaatcatcgtcacgtgtgagatggaggccgcacaaagg
ccgatgttgattttgcacatcctacaacttattcttcccaaacttgaaagctctgtcatg
gataatgtagcggaagccattgaactaggccgtttggctgaatcgctgatagataaactt
gggactggtcatcccccggagacacccaacaagggaacagatatcattgatgaacgactc
taccacctattccaaacatgtatccgtggaattccattggctaccgaaaatagtgctttg
agagaatgcctttacaacatatgctcccaatacttatcccgcattactcgcaatatgtca
gatcacaaccgttttggaagccattcacaacaagctgtcaaggcttcgggttcctcactt
gttgaagttttatgtgacgatgcatattctggacaagaagcctgtcgaatatccgctctg
cttcttctcaaccttcttgctgtccttgatcgtcagctatcctcatcgctgctcatagaa
ttagttgcccaatcgaactatcttgccatgttcgtggatgttgttggggcgataccatca
gagtttcgcaaagcgtctgcaagcgaaacctctcgactatctgtttactacgacacacac
ctgtgtctacttcagcaacttgcgcaatcacgagttggagcagaacgcgtcttagacgca
ggcttgtttcaagctgttaaagagtcccaactctttgccactgaccctgatattggaata
gaaattgataacccagacgctcttcagaaatactatgatctgcttctttccgtaatgcgc
gtgatcgtgtcagcagtttttgcgcgcggcttacacaaccaacaagtccgtgaccaaact
cgcatatttctgtctaaaaatcgacaaagtattgttggcatattcaagcggtatacaaag
atctgtggtctggatgaaaagaagcctagagagacagtagaggatctggtaaagtcatac
atcgcactaatcgaagctgttgggtttcttgaatttgaggatgagcagtcgatcgacaaa
atgggtccaaagtcattttcttag

DBGET integrated database retrieval system