KEGG   Paracoccidioides lutzii Pb01: PAAG_11515Help
Entry
PAAG_11515        CDS       T02230                                 

Gene name
PAAG_02533, PAAG_02534
Definition
(RefSeq) hypothetical protein
  KO
K14310  
nuclear pore complex protein Nup205
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PAAG_11515 (PAAG_02533)
Messenger RNA biogenesis [BR:pbl03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     PAAG_11515 (PAAG_02533)
Chromosome [BR:pbl03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    PAAG_11515 (PAAG_02533)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 2529 aa AA seqDB search
MDGGDELDSLRGLFQDLSSLSRAALPDIDRLVFELEATIQDFRKLLEKPTKKNESRQTVL
SGKIKVHDVEYSVNKEFQQDVLQVADALDLDEIEAADYYLRAQDDARKLDRSPVMSTIIR
FHERRSFLLECLRLVFYESFEVEREGTQAIMQDYVAKILEIQNGPLRNASLFARKCMDSM
VDIEKWLIRLGELAQKASIVGQAQESDLEIIEFQRGSLGKEHESLGAILCYLFKGTFTSS
EDFRLLLDRLRKLDKFDMILVHYIPAIVSSSSQYGSPEGSGSLRDARSLHQAVTSSREPQ
DWLLSKFHATTTALWLAEYSGWYYETSPASPLEGISPERETADLTKLFVTVLDDGALEFM
LEVCAGVSQNQWRDPSRAELVNLLLKDSVPLAIEQDSSSYFHDLLMEHFEIFVESLIANM
PDAIRTLKSEEDIQRLDQITALREGLTTNIHRGPIETRMHFEALLMIMAFAFEHRVDAAQ
EFWADSEGNLYGFLQWASKRQTVPRASAFCEMLCSISEGEENSLSAHKFLLDEEKISPTK
FKRSASMGWTQMIEELQLYATKATERPSAAPPSVFRIRKLEPADIDEPESPVMLTSYLRL
ISHLCRQNSTIRQWILEHPTLNLINVLLTLCDAPIPSHLRSSIFVTFRCLMVDRISVHGN
EMWISLDHWISGSGSQTSGFAKISLVTSSPGWNDRHSFRKIAETFDQTYSFVDLLDTLVS
PPIDLIDSRLSLPFPEALGSSYRMPGIEPYIDFVMGQAFASRSIDLHEPQARLLQLSCFN
FVATCLENFNENLISIINQPSIPLDSGLRSSSLNAYIRLHPFARVMEWIFNEDVLKTMFA
TAHQNIDEVARAASDSILLRCLVRTIDVMNLVMDHQSTYFDVVRPLIKYQTRQTANTVAN
SSLASFEDSVMDNLRLVTDLCLYCGTGHPLLTLASLNLLEKLSSSRKLNRATSSTISRWQ
ASNQIVELLNNDVEAERIARSLAPQMKPDLREIENGPTSSGYLIKLGLVNLLDRCLSMNP
EKPNMAHLLLGFSCLGNTLDIAVEGLFQDKMSLFHAMVDFVQNYPDGENGTILTWMIYLK
ESCFRVLRHLWSSKLSSTLVLPELHQRQLLVTLFITQPQVGPETLWDNFQTTDPEFWYSS
SPDSVSEFLSFRSLLFDYAVTEVRSAARHGSPSLQKDTLSTLLGSSVDENNRTFTHPSFF
DLFDFVDLDIEAVQPPSNLKFFDGSNLDLCAKIQHDGLVIYDLPSVKELLELTKQELLNA
GIATSNDDEQLLAEQNNILLFLRATNQSRKIHHSRYLAVRSWAELATTIIVTCEMEAAQR
PMLILHILQLILPKLESSVMDNVAEAIELGRLAESLIDKLGTGHPPETPNKGTDIIDERL
YHLFQTCIRGIPLATENSALRECLYNICSQYLSRITRNMSDHNRFGSHSQQAVKASGSSL
VEVLCDDAYSGQEACRISALLLLNLLAVLDRQLSSSLLIELVAQSNYLAMFVDVVGAIPS
EFRKASASETSRLSVYYDTHLCLLQQLAQSRVGAERVLDAGLFQAVKESQLFATDPDIGI
EIDNPDALQKYYDLLLSVMRVIVSAVFARGLHNQQVRDQTRIFLSKNRQSIVGIFKRYTK
ICGLDEKKPRETVEDLVKSYIALIEAVGFLEMHNSNRPAPRGGNYKSPGKRKQPEQDPGN
REDLVRKQATITYLFENGWNNISKNGRGEILSPNTKRVKREGLQLPASYPAAPTQLMSIN
KMYTFQNNTDSKSPAGASGRNLSPSNSNGAMPVGSRSRNSTIRSSNFTPHAGAKKLVVKN
LRATPRLDRNRYFEKVWSQLDAALLAILGDQKPEQSLEELYRGAENACRQGRAATLAKKL
QDRCHEHICENVLNSLLLRSEDGNDVDILKSVEEAWATWNARLVSIRSIFYYLDQSFLLH
SADNPVIYEMGLVQFRTAMFLNDTLRPRILQGACQLIELDRKDGNTAVDPNLLRRAIKFF
HDLGVYKKYFEPYMLDASEKYISSWVVNEASHCGLATYVERCQLLISREIQRCDLFGLDR
STKQSISQMVDRYLVSDQIKILLKEDDIVELLNMHSQVALEQLYSLLQRLELGHKIKPAF
FKYITTEGSKIVFDQTNEDRMVTRLLSFKQNLDVILINAFHKDEVLGHTLREAFEVFINK
TQKSESTWGTDNPKPGEMVAKYVDMLLRGGVKAIQSLDGETSIGSTALADEDAEVNQKLD
QVLGLFRFIHGKAVFEAFYKNDLARRLLMGRSASDEAEKSMLARLRSECGSDFTRNLESM
FKDMDLARDEMASYNALLGPKKNRPGLDLNVNVISAAAWPSYPDVPVNLPKIISSSLESF
DQFYNSKYNGRKLHWKHSLAHCQLKAKFPKGDKEIVVSAFQALVLLLFNDVVEGATLSYA
EIREATGLPDVELKRTLQSLACAKYRVLVKRPKGREVNNDDTFAFNLNFSDPKMRIKINQ
IQLKETKQENKIMHERIAADRHYETQAAIVRILKTRKVITHAELVAEVINKTKDRGVLDP
AGIKSNIER
NT seq 7590 nt NT seq  +upstreamnt  +downstreamnt
atggatggcggcgatgaactagatagcctgaggggccttttccaggacctttctagcctc
tccagagctgcccttccagacatcgataggctagtttttgaactagaggcaaccattcaa
gacttcagaaagctcctcgaaaagcccacaaagaaaaacgaaagccgccaaaccgttctc
tccgggaaaattaaggtccacgatgtcgagtactcggtaaataaggaattccaacaggac
gtcttgcaggtggcagacgccttggatttggacgagatcgaagcagccgattactattta
cgagcgcaagacgacgcaaggaaattagaccgctctcctgttatgagtacaattatacgt
tttcatgaacgacgatctttcctcctggaatgcctacgtttagtcttctatgagtcgttc
gaggtcgagagagaaggcacccaagctatcatgcaggattatgttgcgaaaattcttgaa
atccaaaatggccccttacgaaatgcgtctcttttcgcaagaaagtgtatggattccatg
gttgatatcgaaaaatggctgatacgcctgggcgagttagctcaaaaagcttcaattgtg
ggacaagctcaagaatcagatctcgaaattatagaattccaacgcggcagccttggaaag
gagcatgaatctcttggagcgatactgtgctaccttttcaaaggcactttcaccagctcg
gaagatttccgcctactcctagacagacttaggaaactcgataagttcgacatgatatta
gtccattatataccagcaatagtctcctcgtcatctcagtatggctctccggaaggttct
ggatctcttcgtgatgcaagatctctccatcaggctgttacatcttccagagaaccccag
gactggcttttatcaaaatttcatgctactacaacagctctatggctggccgaatactcg
ggttggtattatgaaacttcccctgcgtctcctcttgaaggtatcagtcctgaaagggag
accgctgatctcaccaagttgtttgtcaccgtcctcgatgatggggccctcgaatttatg
cttgaggtctgtgccggcgtcagtcagaaccagtggcgcgatccatcaagggcagagcta
gtgaacctactcctcaaagacagtgtgcccttggcgattgagcaggactcttcttcatat
tttcatgatttactcatggaacacttcgagatattcgtagaatctctcattgccaacatg
cctgatgcgatcaggacattgaaatcggaagaagatattcagcgactggatcaaattact
gctcttcgggagggcctgaccacaaatatacataggggccccattgaaactcgcatgcat
tttgaggctttgctcatgataatggcgttcgcgtttgagcatagagttgacgccgcacaa
gaattttgggcagattcggaaggaaatttatacggatttctccagtgggcgtcgaagcgc
cagactgttcctcgggctagtgccttctgtgaaatgctttgttctatctcagaaggggag
gaaaattccttgtcagctcacaagttcctcttagacgaagaaaaaatatcacccacgaaa
ttcaaaagatccgcatcgatgggctggactcaaatgatagaagagctccagctctatgcc
acaaaagccactgaacgtccttcagcagcaccgccatccgtttttcgtattcggaaactt
gaaccggcggatattgatgaacccgaaagtcctgtgatgcttacttcttacttgagactc
atcagccacctatgtaggcaaaactctacaattcgccaatggatcttggagcatccaaca
ctcaacctcattaacgttcttctaacgctgtgcgacgctcctattccaagccatctgaga
tccagcatatttgtcacctttcgctgtttaatggtggacaggatatccgttcatgggaat
gagatgtggatttctcttgaccattggatttctggttcaggatcccaaacttcaggtttt
gctaaaatatctcttgtgaccagttcacctggctggaacgatcgccattccttccggaaa
atagcagaaacattcgaccaaacatattcatttgttgacctcctggacacattggtatca
ccacctatcgatttgatcgattcgcgactctctcttccctttccagaagcattggggtcc
tcctaccgaatgcccggcatagagccctatatcgattttgtcatgggccaagcattcgct
agtagatccatcgaccttcacgagccacaagctcggcttttgcaactaagctgcttcaac
tttgtagccacctgccttgagaattttaacgagaacctcatttccatcataaatcagcct
tccattccgctagactccggcttgcgatcatcatccctgaatgcgtacattcgattgcat
ccattcgcgagggtgatggagtggatatttaacgaggatgttctcaagaccatgtttgct
acggcgcatcaaaacatcgatgaggtcgcaagggctgcatctgattccatactacttcga
tgcttggtccgaaccattgacgttatgaaccttgtgatggaccaccagtcgacctacttt
gatgtcgtacggccattgattaaatatcaaactagacaaactgcaaataccgtggctaat
tcgtctcttgcgtcgtttgaggatagtgtcatggacaatctccgcctggtcacagatttg
tgcctctactgcggtaccggccatccactgttaactctagcttctctcaaccttttggaa
aagctatccagctcccggaagctaaatagagccacatcgtccacaatatcgcgttggcag
gcatccaatcagatagtggaactattgaacaatgatgttgaggcagagcgcattgctcgc
tctcttgctcctcagatgaaacccgatttgcgagaaatagaaaacggtccaacatcttct
ggctatctcatcaaactagggcttgtaaatttacttgatcgctgtctcagtatgaatccc
gaaaagccaaatatggctcatctccttctgggattttcttgtctgggaaacacgcttgat
atagcagtcgagggattgttccaggacaagatgtcacttttccatgctatggtcgatttt
gtgcagaactaccctgatggggaaaatgggacgattttgacttggatgatttatctcaaa
gaatcgtgcttccgtgtgcttcgacatctctggtcatcgaagctctcttcaacactagtt
cttccagagctccatcagcgtcaactccttgttaccctgttcataactcaacctcaagtc
ggtccagaaaccctctgggataatttccaaactactgatccagaattttggtactcgagt
tcaccagactcggtatcagaatttcttagtttccgcagtcttctttttgactatgccgtg
accgaagttcgctctgcagcaaggcatggctccccttctctgcaaaaagataccctatct
actcttctaggaagttcggttgatgaaaataaccgaacttttacccacccttctttcttc
gacctctttgatttcgtcgatttggatattgaggccgttcaacctccctcaaatcttaag
tttttcgatggcagcaatctggatctatgcgcaaagatacagcacgatggtttagtaatc
tatgatctcccctccgtgaaggagcttcttgaactcaccaagcaagaattactcaacgct
ggaatagcgacatctaatgatgatgaacagctccttgctgaacaaaacaacatattgctc
tttcttcgtgcgactaatcaaagccgaaagattcatcacagccgctacttagctgttcga
tcttgggcagaacttgcgaccacaatcatcgtcacgtgtgagatggaggccgcacaaagg
ccgatgttgattttgcacatcctacaacttattcttcccaaacttgaaagctctgtcatg
gataatgtagcggaagccattgaactaggccgtttggctgaatcgctgatagataaactt
gggactggtcatcccccggagacacccaacaagggaacagatatcattgatgaacgactc
taccacctattccaaacatgtatccgtggaattccattggctaccgaaaatagtgctttg
agagaatgcctttacaacatatgctcccaatacttatcccgcattactcgcaatatgtca
gatcacaaccgttttggaagccattcacaacaagctgtcaaggcttcgggttcctcactt
gttgaagttttatgtgacgatgcatattctggacaagaagcctgtcgaatatccgctctg
cttcttctcaaccttcttgctgtccttgatcgtcagctatcctcatcgctgctcatagaa
ttagttgcccaatcgaactatcttgccatgttcgtggatgttgttggggcgataccatca
gagtttcgcaaagcgtctgcaagcgaaacctctcgactatctgtttactacgacacacac
ctgtgtctacttcagcaacttgcgcaatcacgagttggagcagaacgcgtcttagacgca
ggcttgtttcaagctgttaaagagtcccaactctttgccactgaccctgatattggaata
gaaattgataacccagacgctcttcagaaatactatgatctgcttctttccgtaatgcgc
gtgatcgtgtcagcagtttttgcgcgcggcttacacaaccaacaagtccgtgaccaaact
cgcatatttctgtctaaaaatcgacaaagtattgttggcatattcaagcggtatacaaag
atctgtggtctggatgaaaagaagcctagagagacagtagaggatctggtaaagtcatac
atcgcactaatcgaagctgttgggtttcttgaaatgcataattccaatagacctgcaccg
aggggcgggaactacaagtctccaggaaaacggaaacaacccgaacaagatcctggaaat
cgcgaggatctggtgcggaaacaagcgactatcacgtacctttttgagaacgggtggaat
aacatatcgaaaaacggcagaggggagattctgtctccaaataccaagcgcgtgaaacga
gagggactccagctccctgcctcataccctgccgctcccactcaactaatgtcaatcaat
aaaatgtacacattccaaaataataccgattcaaaatcaccagccggtgcgagtgggcgt
aatctgtcaccttcaaattctaatggcgccatgccggtgggatcccgttcccgcaactcg
acaatccgatcaagcaacttcacaccacacgctggagcaaagaagctggtcgtaaagaac
ctaagagccacacctcgtctagatcggaatcgatactttgagaaagtctggtcgcagctg
gacgctgctctgttggctatccttggggatcagaagccggaacaatctctcgaggagctc
tatagaggggcagaaaacgcctgtcgacagggtagggctgcaactctggccaaaaagcta
caagatcgctgccacgagcacatatgtgagaatgttctaaattcgttattgttgagatcg
gaggatggtaatgatgttgatatcttgaagtcggtggaagaggcttgggctacgtggaat
gctcgtttggtttcaatacgttctattttctactatttagaccaatcgttcctccttcat
tccgcggataatccagtcatttacgagatgggtttagttcaattccgcaccgcaatgttc
ttgaacgatacattgcggccccgcattctacagggagcctgccaactcattgaacttgac
agaaaggatggtaatacggcagttgacccgaacctactcaggcgtgctatcaagttcttt
catgaccttggcgtttacaagaaatattttgaaccatacatgcttgatgcatccgaaaaa
tacatcagcagctgggtcgtcaatgaagctagtcattgcggtcttgctacctatgtagag
cggtgtcaactcctgattagccgtgagattcagaggtgtgatctttttggtctggacagg
agcaccaaacaaagcatatcccaaatggtagatcgttatcttgtctcagaccagatcaag
atcctacttaaagaagatgacattgtcgaactcctcaacatgcatagtcaggtggcacta
gaacaactgtactcgctgctgcaacgtttggagctgggtcacaaaataaagcccgcattc
ttcaagtatatcaccacagaagggtccaagatagtgtttgatcaaacaaacgaagatagg
atggttaccaggctattaagtttcaagcaaaatttggacgttattctgataaatgcattt
cacaaagatgaagtcctaggtcacactctgcgtgaggccttcgaagtgtttatcaacaaa
acgcaaaaatcagaatctacctggggtacggacaatcctaaaccaggtgaaatggttgca
aaatacgtcgatatgctactcagaggtggtgtcaaagcaatccagagcctggatggagaa
accagcatcggcagcacggccttggctgatgaagatgcagaggtaaatcagaagttggac
caagtattgggtcttttccgttttattcatggaaaagccgttttcgaagccttttataag
aacgatcttgcccgccgtcttcttatgggtagaagtgcaagtgatgaggctgaaaagagt
atgcttgccagactcagatcagagtgcggttcggatttcacccgtaatctcgagtctatg
ttcaaggacatggatcttgcgcgggatgaaatggcctcctacaacgcgctactaggacca
aagaagaacagacctggcttggatctgaacgtgaacgtcatatcagcagcagcatggcct
tcgtatccagatgtgccagtgaatttgccgaagataatatcatcttccttggaaagcttc
gatcagttttacaatagcaagtacaacggacgaaaacttcactggaagcattcgcttgcg
cactgccagctaaaggctaaattccccaaaggtgacaaggaaatcgtcgtgagcgcgttc
caagccctcgttctcctcctattcaatgacgtagtggagggcgccactctatcatacgca
gaaatcagggaagctactggcctgcctgacgtcgaattgaaacgcactctccaatcccta
gcctgcgcgaaataccgagttctggtcaagcgaccaaagggtcgagaggtaaacaacgac
gacactttcgccttcaacttgaacttctccgatcccaagatgcgcatcaaaatcaaccag
atccaactcaaggagaccaagcaggagaacaagattatgcatgaacggattgcggcagac
cggcattacgaaacacaggcagccattgtgcgcattctaaagacccggaaagtcatcacg
cacgcggagctagtggcggaggttatcaataagacgaaagatagaggggtgttggatccg
gctggtatcaaatctaatattgaaaggtga

DBGET integrated database retrieval system