KEGG   Paracoccidioides brasiliensis: PAAG_02653Help
Entry
PAAG_02653        CDS       T02230                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAAG_02653
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAAG_02653
   00620 Pyruvate metabolism
    PAAG_02653
   00640 Propanoate metabolism
    PAAG_02653
  Energy metabolism
   00680 Methane metabolism
    PAAG_02653
Enzymes [BR:pbl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PAAG_02653
Lipid biosynthesis proteins [BR:pbl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PAAG_02653
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 669 aa AA seqDB search
MSDGPVIPPKGPVVIEAHEVDTFHVPQAFLDKHPTRTHLKDLDEYKKLYEESIRDPDTFW
SRLARELLTWERDFDTARYGTFEMGNVAWFLGGRLNASYNCVDRHAIKDPNKLALIYEAD
DPGEGRNITYGELLKEVSRLAWVLKQAGVKKGDTVAIYLPMIPEAVIAFLACVRIGAVHS
VVFAGFSSDSLRDRVLDARSRVVITTDEGKRGGKLIGTKKIVDEALKQCPDVNHCIVYKR
TGADVPWTKGRDMWWHEEVEKYPNYIVPEPMDSEDPLFLLYTSGSTGKPKGLMHTTGGYL
VGAAATGKYVFDIHPTDRFFCGGDVGWITGHTYVVYAPLLLGCASVIFESTPAYPNFSRY
WDVIQKHKVTQFYVAPTALRLLKRAGNQYIHHKLETLRILGSVGEPIAAEVWKWYFEVVG
KEECHLVDTYWQTETGSHVITPLGGITPTKPGSASLPFFGIEPAIIDPTSGEEIKGNDVE
GVLAIKHPWPSMARTVWGAHKRYMDTYFNVYKGFYFTGDGAGRDIDGYYWIRGRVDDVVN
VSGHRLSTAEIEAALIEHHAVAEAAVVGIADELTGQAVNAFVSLKNGDDGESLRKDLVLQ
VRKSIGPFAAPKAVFVVEDLPKTRSGKIMRRILRKILSGEEDSLGDISTLSDPSVVAKII
DIYQATKSK
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatggaccggttataccccccaaagggccagtggtcatcgaagcccacgaagtc
gacactttccatgtcccgcaagcctttctggacaagcatcccaccagaactcacctaaag
gatcttgacgagtacaagaaactctacgaagaatcgatccgggatccagataccttttgg
tcaaggctggcccgcgagctcctgacgtgggagcgtgattttgacactgcccgttatgga
acttttgaaatgggaaatgttgcctggtttctcggtgggcgtttgaatgcttcgtataat
tgtgttgatcgtcatgcgatcaaggacccaaataagttggcgctcatttatgaggcggat
gatcccggcgaaggccgcaacattacatacggggagcttctgaaggaggtttcgcggtta
gcttgggtattgaagcaggctggcgttaagaagggggacactgttgcaatctacctgccc
atgattccagaggctgttattgcgttcctggcgtgtgttcgcattggtgcggttcactca
gtcgttttcgctggattctcctctgattcgctccgggaccgcgttttggacgcgcgctcc
agggtcgttattaccacggatgagggcaagcgcggtgggaagctcattgggacgaagaag
atcgtggatgaggcccttaagcaatgccctgacgtgaatcactgcatagtgtacaagaga
acgggtgccgatgtgccctggactaagggtcgggacatgtggtggcatgaggaggtcgag
aagtatcctaactacatagttccggagccgatggattcagaggaccctcttttccttctg
tacacgtcagggtcaactggaaaaccaaagggcctgatgcacacgactggcggctatttg
gttggcgcagctgcaactggcaaatatgtatttgacatccatcccaccgaccgcttcttc
tgtggtggggatgtaggctggattacaggacacacctatgtcgtctatgctcctctgctt
ctcggatgcgcaagtgtgattttcgagagtactccagcatatcccaacttctcccggtac
tgggatgttattcagaagcataaagtgacccagttctacgttgccccaacggcgctgagg
ctcttgaaacgcgctggaaatcaatacatccaccacaaacttgagactcttcgtatcttg
ggatccgtcggtgaaccaattgccgcagaggtgtggaagtggtatttcgaggttgttgga
aaggaagaatgccatcttgtcgacacatactggcaaaccgagactggctctcatgttatt
actccactgggtggcatcacgccaaccaaacctggcagtgcctcccttcccttctttggc
attgagcccgccattattgatccgacgtcaggagaggaaatcaaaggtaatgatgttgaa
ggtgttttggccattaagcatccatggcccagcatggcccgcacggtatggggtgctcac
aagagatatatggacacctatttcaatgtttataagggattttatttcactggtgatggt
gctggtcgagatatagacggatactattggattcggggccgtgtcgatgatgttgtcaac
gtttctggccatcgtctatcaacagcagaaattgaagctgctctcattgaacatcatgct
gttgctgaggctgctgtcgttggtattgccgatgaactcaccggacaggctgttaatgca
tttgtttcgctgaaaaatggggacgacggcgaatcactccgcaaagatctcgttttgcaa
gttcgcaagtcaattggtccatttgctgcacccaaggctgtgttcgttgtcgaagacctg
cccaagactcgaagcggtaagattatgcgacgaattttgagaaagattctcagcggagag
gaggacagcctgggtgatatctcaactctatctgatccaagcgtcgttgccaagatcatt
gacatctaccaagcgacaaagagcaagtga

DBGET integrated database retrieval system