KEGG   Paracoccidioides lutzii Pb01: PAAG_11533Help
Entry
PAAG_11533        CDS       T02230                                 

Gene name
PAAG_02668
Definition
(RefSeq) histone acetyltransferase MYST2
  KO
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
pbl  Paracoccidioides lutzii Pb01
Brite
Enzymes [BR:pbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PAAG_11533 (PAAG_02668)
Chromosome [BR:pbl03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    NuA3 complex
     PAAG_11533 (PAAG_02668)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 627 aa AA seqDB search
MAATVPASYGNTTIDHQPDLVDSDQDAEGDEDDELYPALPPSATTVSQGIDDRTPNHRKD
VEAIVTNDRESNEVEIGQPIQDGSAGEDDIPDANDKDFVADVDVDDDEETEAVGAVKFPD
GEANSDIDDADDDPDDPDAAFENESSESKVNSNIDSSEESEVDEEWEAESNDKDDVDADA
LNPNNCIVCGQDEEHDPGEEFEDYLSCAVCGDHCHRQCARERGALNNEEDAENWRCPGCV
KNNLEPDKPAETASRRKSGTSNFARDLLPAHSKELGPESHSIFSSLIVDDDPLDGSRSLR
KRRASDDVPESSNTAPQKRQKKTPTRFEGMIPTPLPRNMKAVQALIENSAESNFTPRQSR
SRRARKTEMPLCRIVQRQHGKIVLSFRLNSTKLNKILSSQPKPKNSRRRPPKPPPAAEPH
QSHFHPVTPLPYSAPFYSFHDRENDELKSKPYGGILSEADADTSKTLPLAPDREKFEAAR
QKAEEEWRQKMNAAEQDGESAPRASQKVSGPPSKIKYISFGGYEIETWYAAPYPEEYSRN
RVLYICEFCLKYMNSDFVAWRHKLKCPAKHPPGDEIYRDGSVSVFEVDGRKNPVYCQNLC
LLAKLFLGSKTLYYDVETISILCHDRI
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgacagtgccggcctcatacggaaacaccacgatcgatcatcagccagacctg
gttgacagtgaccaggatgcagagggtgacgaggacgatgagttatatcctgccctccca
ccatctgcaactaccgtatcgcagggaattgacgataggacgccaaatcaccggaaggat
gttgaggcaatcgtaaccaacgatcgagaatcgaatgaggttgaaatagggcaaccaatt
caggatggctctgctggggaggatgatataccagacgccaacgataaggattttgttgct
gatgttgatgttgatgacgatgaggagactgaggctgtcggggctgtaaagttcccagac
ggtgaagccaactccgacatcgatgacgcagacgacgatcctgatgacccagatgctgcg
tttgaaaacgaatccagcgagtccaaggtgaactccaatatcgactcttctgaggaatcg
gaagtagatgaggaatgggaggccgaaagcaatgacaaagatgatgtagatgcagatgca
ttaaatccaaacaattgcatagtctgtggccaagatgaggaacatgatcctggtgaagaa
ttcgaggactatttatcctgtgctgtttgtggtgatcattgtcatcgtcaatgcgcacga
gaacgaggagctttaaataacgaagaagatgctgaaaattggaggtgccccggctgtgtt
aaaaacaatctggaacctgacaagcctgcggaaaccgcatcccgacgaaaatctggcaca
tctaacttcgcaagagatctgctacccgcacatagcaaagagttgggaccagaatctcat
tccattttcagctcattaattgtcgacgatgatccgttggatggttcgagatcactccgg
aaacgcagggcttcggatgatgttcccgaaagttccaacaccgcccctcaaaagcgacag
aagaaaacgcccaccagattcgaggggatgatcccgactcctctgcccaggaacatgaaa
gcagtccaggcattaatcgaaaattctgcagagagcaattttacaccccgccagtcaaga
tcacgcagagcacggaagaccgaaatgcccctctgtagaattgttcagcggcagcatgga
aagatcgttctttcatttcgcctaaacagcacaaaattaaataagatcttgagttcccaa
ccaaaacccaaaaattcaagacggagacctccaaaaccacctccagcagctgaaccacac
caatcgcactttcaccctgttacacctttgccatacagcgctcccttctactcctttcac
gaccgggaaaacgatgaattgaaatcaaaaccgtacggaggaatattatcagaagctgat
gctgacacatcaaaaacacttcctcttgccccagatcgtgagaagttcgaggctgctcgt
caaaaagccgaagaagaatggagacaaaaaatgaacgctgctgagcaagacggggagtcc
gcacctcgtgcttcacaaaaggtctccggcccaccaagtaaaattaaatacataagcttt
ggtggttatgagattgaaacatggtatgctgcaccctatccagaggagtatagtagaaat
cgagtgctctacatttgcgaattctgcctcaaatatatgaattcggatttcgtcgcttgg
cgccacaaactcaaatgtccggcgaaacatccgcctggagacgagatctaccgtgatgga
tctgtctctgttttcgaggttgacggccgcaaaaacccggtatattgccaaaacctttgc
ttgcttgcgaagctcttcctcgggtctaaaactctctattacgacgtcgaaaccatttct
attttatgtcatgaccgaatatga

DBGET integrated database retrieval system