KEGG   Paracoccidioides brasiliensis: PAAG_02767Help
Entry
PAAG_02767        CDS       T02230                                 

Definition
ATFPG-1/ATFPG-2/ATMMH-1/ATMMH-2/FPG-1/FPG-2
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    PAAG_02767
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     PAAG_02767
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     PAAG_02767
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 369 aa AA seqDB search
MPELAEVARVVHYIRKYLVGKTITKVHVQDDPIVFGKVGTTAAEFQKHMEGKSIVDTGQQ
GKYFWMIMSSPPHPVMHFGMTGWLKLKNVHTYYYRAPASDKGNDRGEEPWPSKFWKFMLE
LDDEPKTEAAFVDARRLGRVRLVDCPGADIRKYSPLKENGPDPIVDKDIVTLDWLRKKVL
SKRVPIKALLLDQTNISGIGNWMGNTLQESQIEQLYSAINYVCSTSVGLLGNSEEFPSNW
LFSHRWSKGKTNHSHKLPNGEKIVFITVGGRTSAIVPAIQKKTGPVAGDVEDEAMDDNNE
PPKKKRGIVSKESKYVENGETHTPAKKPAMKKPKDEPKIKESKSKKQTDAAQTEENKTPK
NRRSTRSRK
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctagctgaggttgcacgggtcgtccactacattcgcaaatatctcgtgggt
aaaaccatcaccaaagttcatgtccaagatgaccctatcgtctttggtaaggtgggaaca
acagctgcggagttccaaaagcacatggaaggaaaatcgatagtggatacgggacaacag
gggaaatatttctggatgatcatgtcttccccgcctcatcccgttatgcattttggtatg
actggatggctgaagttgaaaaatgtccatacatattactatagagccccagcatccgac
aaagggaacgacagaggggaggaaccgtggccgtcaaaattctggaaatttatgcttgag
cttgatgatgaaccgaagactgaggctgcgtttgtggacgcgagacgtcttggtcgtgtg
cgattggtcgattgtcctggtgctgatattaggaaatatagtcctctcaaggagaatgga
ccagaccccattgtggataaggatatcgtgaccttggattggctgagaaaaaaagttttg
agcaaaagagtgcctattaaggcgctcctgcttgaccaaaccaatatcagtggaattggg
aattggatgggcaataccctccaggaaagccagatcgaacagctctactccgcgatcaac
tatgtgtgctcgacatcggttggtctcttgggaaattcggaggagttcccgtccaattgg
ttattcagccaccggtggagcaagggtaaaacaaaccattcacataaacttcccaatggt
gaaaagattgtttttattacagttggcggtcgcaccagtgctatagtaccagctatccag
aaaaagacagggcccgttgcgggagatgtggaagatgaggccatggatgacaacaatgag
ccccccaaaaagaagagaggaattgtttcaaaggagagtaaatatgtggaaaatggtgaa
actcatactcccgcgaagaaacctgcgatgaagaagccaaaagatgaaccaaaaataaag
gagtctaagagtaagaaacagacggacgctgcccaaacggaagagaacaaaaccccaaag
aaccgtagatccacaaggtcaagaaagtag

DBGET integrated database retrieval system