KEGG   Paracoccidioides brasiliensis: PAAG_02767Help
Entry
PAAG_02767        CDS       T02230                                 

Definition
ATFPG-1/ATFPG-2/ATMMH-1/ATMMH-2/FPG-1/FPG-2
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:pbl03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 369 aa AA seqDB search
MPELAEVARVVHYIRKYLVGKTITKVHVQDDPIVFGKVGTTAAEFQKHMEGKSIVDTGQQ
GKYFWMIMSSPPHPVMHFGMTGWLKLKNVHTYYYRAPASDKGNDRGEEPWPSKFWKFMLE
LDDEPKTEAAFVDARRLGRVRLVDCPGADIRKYSPLKENGPDPIVDKDIVTLDWLRKKVL
SKRVPIKALLLDQTNISGIGNWMGNTLQESQIEQLYSAINYVCSTSVGLLGNSEEFPSNW
LFSHRWSKGKTNHSHKLPNGEKIVFITVGGRTSAIVPAIQKKTGPVAGDVEDEAMDDNNE
PPKKKRGIVSKESKYVENGETHTPAKKPAMKKPKDEPKIKESKSKKQTDAAQTEENKTPK
NRRSTRSRK
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctagctgaggttgcacgggtcgtccactacattcgcaaatatctcgtgggt
aaaaccatcaccaaagttcatgtccaagatgaccctatcgtctttggtaaggtgggaaca
acagctgcggagttccaaaagcacatggaaggaaaatcgatagtggatacgggacaacag
gggaaatatttctggatgatcatgtcttccccgcctcatcccgttatgcattttggtatg
actggatggctgaagttgaaaaatgtccatacatattactatagagccccagcatccgac
aaagggaacgacagaggggaggaaccgtggccgtcaaaattctggaaatttatgcttgag
cttgatgatgaaccgaagactgaggctgcgtttgtggacgcgagacgtcttggtcgtgtg
cgattggtcgattgtcctggtgctgatattaggaaatatagtcctctcaaggagaatgga
ccagaccccattgtggataaggatatcgtgaccttggattggctgagaaaaaaagttttg
agcaaaagagtgcctattaaggcgctcctgcttgaccaaaccaatatcagtggaattggg
aattggatgggcaataccctccaggaaagccagatcgaacagctctactccgcgatcaac
tatgtgtgctcgacatcggttggtctcttgggaaattcggaggagttcccgtccaattgg
ttattcagccaccggtggagcaagggtaaaacaaaccattcacataaacttcccaatggt
gaaaagattgtttttattacagttggcggtcgcaccagtgctatagtaccagctatccag
aaaaagacagggcccgttgcgggagatgtggaagatgaggccatggatgacaacaatgag
ccccccaaaaagaagagaggaattgtttcaaaggagagtaaatatgtggaaaatggtgaa
actcatactcccgcgaagaaacctgcgatgaagaagccaaaagatgaaccaaaaataaag
gagtctaagagtaagaaacagacggacgctgcccaaacggaagagaacaaaaccccaaag
aaccgtagatccacaaggtcaagaaagtag

DBGET integrated database retrieval system