KEGG   Paracoccidioides brasiliensis: PAAG_02835Help
Entry
PAAG_02835        CDS       T02230                                 

Definition
hypothetical protein
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
pbl  Paracoccidioides brasiliensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 571 aa AA seqDB search
MHCLLPLFHILVLYCFIVFGFRADIRADSNRDGKVDLVGNTDLTHKLSTSNNAGAIFLAN
IGDTDRRCSKSALQGRPPSNEELAACNDASNDLQRSPRFMAPLRTVPIPSLSRKAYGTKA
YGTIAITNAEARKNVRIFRREGFQWLITPAGYRFPPSQPGKGLELGIDGRNTRRPGEWDG
RVTIQCTVHDKGKTSVDSVKLRVAPILTHHHSESVRQIITTAGNNTGNFFQGRFVSALEG
ALAKMDIKIPLFQFNASDDIWAQDFFEPGYTGMPGPDGPIALQIMICSAQDGRIAGRQVF
EYLRGPETGAVQHPGGARDEINSMGNLETIPPYIFNGREYPAGRIILGTHGLKKPHILEF
LLAQEVQDPLLLDTDWLAIGHVDEFIQFLPSNNSLGWVMLFPDPQEGLNLLRRAQSAGHG
SVRAFSRQNDTEGNPHDLFGVPGGLRGVPSYTINDLLSQNHTVEANARFSKRIKTNIDLL
KRETGIKDTDIYAVPAVFRTSLTYPPNVGVDPKRNGSSELAASLYPSTINGLVLSDTQYL
APNPWGPVIGGVDIMADAALKVYGVTGGNKF
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgcattgtttgcttcctttatttcatatacttgtcttatattgtttcatcgtttttggt
tttcgagctgatatccgagccgatagcaatcgtgacggcaaggttgatcttgtcggaaat
acagacctaacccataaattgagcacttcgaacaatgccggggcgatattccttgcgaat
atcggcgacacggatcggcgatgttccaaatcagcactgcaaggcagacctccgtccaac
gaggaacttgcagcttgtaatgatgcgtcaaacgaccttcagcgatctcctcgttttatg
gcgcctcttcgcaccgttcccattcctagcttaagtcgaaaagcttatgggactaaagct
tatgggactattgctattactaacgcagaggcacgcaaaaatgttcgcattttccgtcgt
gaggggtttcaatggttaatcacgccagcaggttacagattcccaccaagtcaacctgga
aaaggtctagaactagggatagatggtaggaataccaggcggccaggtgaatgggacgga
agagtaaccatacaatgtactgttcacgacaaagggaagacgtcagtggatagcgtgaaa
ttacgggttgcacctatcttaacccaccatcactccgaatcagtccgacagattatcacc
actgctggaaataatactggcaattttttccaaggcagattcgtatctgctcttgaagga
gctctcgccaaaatggacatcaagattccacttttccagtttaacgcatctgatgacatt
tgggcgcaagatttcttcgagccagggtataccggcatgccaggtcctgatgggccgatt
gcactgcaaatcatgatatgctccgcgcaagatggccgcattgctgggcggcaggtattc
gagtacctacgagggccagaaactggagcggtccagcaccctggaggagcgcgtgacgaa
atcaattcgatggggaatttagaaactatcccaccttacatttttaacggcagagaatac
cctgctggtcgcatcattctcgggacacacggactcaagaagccacatatcctagaattc
ctactggcacaggaagttcaagacccgctacttctagacactgactggcttgcgattgga
catgttgacgagtttattcaattccttccttccaataattctttgggatgggttatgctg
ttcccagatccgcaggaaggccttaatctcttgcggcgagctcaatcggctgggcacggc
agtgttcgcgcattttcccgccagaatgacacagaagggaatccgcatgatctgtttggg
gtccccggtggcctccgcggtgtaccaagttatacgatcaatgacctactttcccaaaac
catacggtagaagcgaacgccagattttccaaacgtatcaagactaacatagaccttctc
aaacgtgaaacgggtattaaagacacagacatatatgctgtgcccgcagtgtttcgcact
agcctcacctatccaccgaatgtaggtgtcgatcctaaaagaaatggtagctctgagttg
gctgcgtctctttatccttctacgatcaacgggttggtgctgagcgatacacaatacctg
gcaccaaacccctggggcccagttataggtggcgtcgatatcatggcagatgcggcgttg
aaggtatatggagttactggtggtaacaaattctga

DBGET integrated database retrieval system