KEGG   Paracoccidioides lutzii Pb01: PAAG_03005Help
Entry
PAAG_03005        CDS       T02230                                 

Definition
(RefSeq) sphingosine kinase
  KO
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PAAG_03005
Enzymes [BR:pbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     PAAG_03005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 515 aa AA seqDB search
MTFGNFVDAGPSGGKATRLSAEELCNPHAESDETLAVVQNAFLTLSDDALTIIDNGLKAG
SRRRCCGFPFSPKDYSRDLEASRLIPYFNILWADISDGYITVKYAEQVSKKDIRLGSLYY
PISSENRSKAGAWIEKLLDLAYGKAQRKKRIKVLINPFGGIGKAPKYYNKKVEPIFAAAR
CKIDVESTTYRGHAIDIVEKLDIDAYDVVAACSGDGVIYEIFNGLAKKPNAGEALRKIAV
AHIPCGSGNAMSWNLNGTGSASLAALCIVKGLRTPLDLVSITQGNRRTLSFLSQAFGITA
ESDLGTDNIRWMGQARFTYGFLVRLFGKTVYPCDLAVKVEIGNKQQIKDHYRTESARKGF
DQFRDKGSSAQTGLPALRYGTINDPLPEGWTLVPHDNMGNFYAGNMAYVAADTNFFPAAL
PNDGYMDLVTINGDIGRWTAIQMLKAVDNGTLFDMPEIKVQKITGYRIIPRDRKQGYISI
DGEQIPFEPFQAEVHKGLGTVLSKSGYKYEAEGVK
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgactttcggaaactttgtcgacgctggtccatctgggggcaaagcgacacgattgtcc
gcggaagaattatgcaatccgcatgcagaaagcgacgaaacgcttgctgtcgttcaaaat
gctttcttaactctgtcagatgatgcgctgactattatcgataatgggctgaaggcgggc
tcacggcgccgttgttgcggctttccattctctccgaaagattactcccgagatctcgaa
gcctcgcgattgattccttatttcaacatcctctgggctgatatatctgatggctatatc
accgttaagtatgctgagcaggttagcaaaaaagatatcagacttggttcactgtattat
ccaattagctctgaaaacaggtcgaaagcaggcgcatggatcgagaaacttttggatcta
gcttacggcaaagcacagcggaaaaagcgtataaaggtcttgatcaatccttttggcgga
atcggcaaggcgcccaaatattacaacaaaaaggttgagccaatatttgccgctgcgaga
tgcaaaattgatgtcgaatcgacaacatatcgaggacacgcaatcgatatcgtggagaag
ctcgacatcgatgcatatgatgttgtcgcagcctgctcaggtgatggtgtaatctacgag
attttcaatggcctggccaagaaaccaaatgctggcgaagccctgagaaaaattgccgtt
gctcatataccctgcggatcaggaaacgcaatgagctggaacctcaatggaactggcagc
gccagcttggcggcactttgtatcgtcaaagggctgagaacacccctggatttggtctcc
attacccaaggtaatcgacgtacgctatcattcttgtcccaggccttcggtattacagca
gaatcagatcttggaaccgacaacatccgatggatgggtcaggctcgcttcacgtacgga
ttcctagtccgcctttttggaaaaacagtttatccttgtgacttggctgtgaaagtcgaa
atcggcaataagcagcagatcaaagatcactatcgtactgaatctgcaaggaaaggcttc
gatcaattccgcgataagggatcttctgcacagactggccttccggctctgcggtatggt
accattaacgatccgctacctgaaggctggactctggtaccccacgacaatatgggcaat
ttctacgcggggaatatggcatatgtggctgcggatacgaatttctttcccgctgcacta
cccaacgacgggtatatggatcttgttacaatcaatggtgatatcggccgatggactgct
atccagatgctaaaggctgtggataacggcacgctgtttgatatgcctgagatcaaggtc
cagaagattactgggtacagaatcatccccagagaccggaaacaaggttacattagtatc
gatggggagcagataccatttgagcctttccaggcagaagttcacaaagggctcggaact
gtactatccaagtctggatacaaatatgaagctgaaggagtgaagtaa

DBGET integrated database retrieval system