KEGG   Paracoccidioides brasiliensis: PAAG_03005Help
Entry
PAAG_03005        CDS       T02230                                 

Definition
sphingosine kinase
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pbl00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 491 aa AA seqDB search
MTFGNFVDAGPSGGKATRLSAEELCNPHAESDETLAVVQNAFLTLSDDALTIIDLEASRL
IPYFNILWADISDGYITVKYAEQVSKKDIRLGSLYYPISSENRSKAGAWIEKLLDLAYGK
AQRKKRIKVLINPFGGIGKAPKYYNKKVEPIFAAARCKIDVESTTYRGHAIDIVEKLDID
AYDVVAACSGDGVIYEIFNGLAKKPNAGEALRKIAVAHIPCGSGNAMSWNLNGTGSASLA
ALCIVKGLRTPLDLVSITQGNRRTLSFLSQAFGITAESDLGTDNIRWMGQARFTYGFLVR
LFGKTVYPCDLAVKVEIGNKQQIKDHYRTESARKGFDQFRDKGSSAQTGLPALRYGTIND
PLPEGWTLVPHDNMGNFYAGNMAYVAADTNFFPAALPNDGYMDLVTINGDIGRWTAIQML
KAVDNGTLFDMPEIKVQKITGYRIIPRDRKQGYISIDGEQIPFEPFQAEVHKGLGTVLSK
SGYKYEAEGVK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgactttcggaaactttgtcgacgctggtccatctgggggcaaagcgacacgattgtcc
gcggaagaattatgcaatccgcatgcagaaagcgacgaaacgcttgctgtcgttcaaaat
gctttcttaactctgtcagatgatgcgctgactattatcgatctcgaagcctcgcgattg
attccttatttcaacatcctctgggctgatatatctgatggctatatcaccgttaagtat
gctgagcaggttagcaaaaaagatatcagacttggttcactgtattatccaattagctct
gaaaacaggtcgaaagcaggcgcatggatcgagaaacttttggatctagcttacggcaaa
gcacagcggaaaaagcgtataaaggtcttgatcaatccttttggcggaatcggcaaggcg
cccaaatattacaacaaaaaggttgagccaatatttgccgctgcgagatgcaaaattgat
gtcgaatcgacaacatatcgaggacacgcaatcgatatcgtggagaagctcgacatcgat
gcatatgatgttgtcgcagcctgctcaggtgatggtgtaatctacgagattttcaatggc
ctggccaagaaaccaaatgctggcgaagccctgagaaaaattgccgttgctcatataccc
tgcggatcaggaaacgcaatgagctggaacctcaatggaactggcagcgccagcttggcg
gcactttgtatcgtcaaagggctgagaacacccctggatttggtctccattacccaaggt
aatcgacgtacgctatcattcttgtcccaggccttcggtattacagcagaatcagatctt
ggaaccgacaacatccgatggatgggtcaggctcgcttcacgtacggattcctagtccgc
ctttttggaaaaacagtttatccttgtgacttggctgtgaaagtcgaaatcggcaataag
cagcagatcaaagatcactatcgtactgaatctgcaaggaaaggcttcgatcaattccgc
gataagggatcttctgcacagactggccttccggctctgcggtatggtaccattaacgat
ccgctacctgaaggctggactctggtaccccacgacaatatgggcaatttctacgcgggg
aatatggcatatgtggctgcggatacgaatttctttcccgctgcactacccaacgacggg
tatatggatcttgttacaatcaatggtgatatcggccgatggactgctatccagatgcta
aaggctgtggataacggcacgctgtttgatatgcctgagatcaaggtccagaagattact
gggtacagaatcatccccagagaccggaaacaaggttacattagtatcgatggggagcag
ataccatttgagcctttccaggcagaagttcacaaagggctcggaactgtactatccaag
tctggatacaaatatgaagctgaaggagtgaagtaa

DBGET integrated database retrieval system