KEGG   Paracoccidioides lutzii Pb01: PAAG_03235Help
Entry
PAAG_03235        CDS       T02230                                 

Definition
(RefSeq) lysophospholipase
  KO
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PAAG_03235
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PAAG_03235
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 644 aa AA seqDB search
MRSDLATLCSALVVATVSASTVSAAYGPIRDVAVRALPNAPDGYTPAYVSCSGNRPTVRS
AAALSPNEKSWLEERRQKTNAAMKDFFGHVTIDGFEARSYLEKFAQNVSALPNVAIAVSG
GGYRALMNGGGALKAFDSRTVNSTSPGRLGGLLQSATYLAGLSGGGWLVGSLYLNNFTTV
SQLVADEEGSVWEFSESIFKGPMEKGSKLLNTVDYYQQINDAMQGKKDAGFDITLTDYWG
RALSYQLINGPEGGLNYTWSSIALGQSFKDGDMPFPILVAGGRNPGELFIGGNATVFEFN
PFEFGTFDPTVFGFVPLEFLGSKFDAGSLPQSESCVRGFDNAGYIMGTSSSLFNQFLLNL
SGVDIPTFIKDALRSILESIGRNNNDIAAYEPNPFYHYSNNTSPFAKEKSLNVVDGGEDL
QNIPLHPLIQPERHVDVIFAVDSSADNEFNWPNGTALVATYQRSLNSKVANGTAFPAIPD
VNTFVNLGLNKRPTFFGCNSSNMTGPSPLVVYIPNAPYIFFSNVSTFDLQYSTTERNAII
QNGYNVATMGNGTVDANWPTCVGCAMLSRSFERTNTEVPEACRKCFNTYCWDGKTNSSVP
LVYAPGIQLEPLKITSMAAGITPSIPTLLVVAGVWNYVFLQWHH
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcggacctagcaacactatgcagtgccctcgttgtagcaacagtttcagcatcg
actgtttctgcggcgtatggacctattcgagatgtagcggtgcgggccctcccaaacgct
cctgatggatacacccctgcctatgtgagctgcagcggtaaccgtccaacggtgcgcagc
gcagcggcgctttcaccaaatgaaaaaagttggctagaagagagaaggcagaaaacaaac
gctgcgatgaaagatttcttcggtcacgtcactattgatggcttcgaagcaagatcatat
cttgaaaaatttgcccaaaacgtttctgcgctgccaaatgttgcaattgcggtttcgggt
ggggggtacagggctctgatgaatggcggcggggcattgaaggcgtttgatagccggaca
gtcaattccacaagccctggacgtcttggtgggcttctgcagtcagccacctatctcgct
ggtctgagcggcggtggatggcttgttggatcgctctatcttaacaatttcaccactgtc
tcacagcttgtggctgatgaggaaggttcagtgtgggagtttagcgagtctatatttaaa
ggcccaatggaaaagggtagcaaacttctcaacaccgtggattattatcagcaaataaac
gacgcaatgcaagggaagaaagacgcgggatttgacattacacttacggattattggggt
cgtgcattatcgtaccaactcatcaatgggcccgagggtggacttaattacacgtggtcc
tcgattgctctcggccagagttttaaagatggagatatgccgttcccgatccttgttgcg
ggcggaagaaatccaggggaattgttcattggaggaaacgccacggtattcgaatttaac
ccttttgaatttggcaccttcgacccaactgtttttggctttgttccgttagagttcctc
ggatcgaaatttgatgcaggatcgttgcctcaatcggaatcttgtgtgcgcgggtttgac
aatgcgggttatatcatgggcacctcgtcatccctcttcaaccaatttttactgaacctt
agcggcgttgacattccaacattcatcaaggacgctctgagatctattctcgagtcgatc
ggaagaaacaacaacgatattgcggcatacgaacccaatcccttttatcattactctaac
aatacatcccccttcgcaaaggaaaaatctctcaatgtcgtcgatggtggggaagatctg
caaaatattccactgcatcctttgatccaaccagagcggcatgtagatgtaatctttgcc
gtagactcttcagcggataatgaattcaactggccaaatggtaccgccctcgtcgctacg
tatcagcgcagcctgaattccaaagttgccaacggcaccgcgttcccagcaatcccagat
gtgaatacgttcgtcaatctgggtcttaacaagaggcccactttcttcgggtgtaatagc
tcgaacatgacggggccttctcctctggtggtctacatccccaacgcaccttatatattt
ttctcgaacgtctcaactttcgatttgcaatacagcacgactgagcggaatgcgatcatc
cagaacggatacaacgtcgccactatgggaaatggtactgttgacgccaactggcccacc
tgcgttggctgtgccatgctcagcaggtcttttgagcgcaccaacacggaagttccagaa
gcctgccggaagtgcttcaacacgtattgttgggatggaaagaccaatagctctgttcca
ctagtctatgcccccggaattcagctcgaaccgttgaagatcaccagcatggcggctggc
atcaccccgagtatcccaactctccttgtcgttgctggtgtgtggaactatgtgtttttg
cagtggcatcattga

DBGET integrated database retrieval system