KEGG   Paracoccidioides brasiliensis: PAAG_03243Help
Entry
PAAG_03243        CDS       T02230                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pbl00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 318 aa AA seqDB search
MERANKPTAIPVHSPLPQPTISVQEDQVQASLASGESVTVNLFGATVVSWKLANGEEQLF
LSEKAALDGSKPIRGGIPLVFPVFGPPPKGHATSALPQHGFARNVHWEFLGKSTSESEGQ
NGDSSVKLDFGLSMSMLSDKFKKDWPYDFGLLYSVTLSKGSLITSLQVQNKGAQPFDFQA
LLHSYFRVKDITKIRLLNLQSATYVDKLLNASVHVESSPALSFTQETDRIYQSLDPTVPI
IVADADNNNSPIFSITRESLNDVVVWNPWIEKAKGMADFAPDDGYKNMICVEAGSVAGWQ
TLEAGESWEGGQTVRSKL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgcaaataaacccacagcaattcctgtgcactctccgctcccgcagcccact
atctccgtgcaagaagatcaagtccaggcttcactggcctccggcgaatccgtcactgtc
aatttgtttggcgcgactgtagtgtcctggaagcttgccaatggcgaggaacagcttttt
ttgagcgagaaagctgcgctggatgggtccaagccaatacgcggcgggattccattggtt
ttccccgttttcggccctcctcccaaaggccacgcaacttccgcactcccccagcacggg
ttcgcccgcaatgtacattgggaatttcttgggaaatcgacttccgaatcagagggacag
aatggcgatagcagcgttaagcttgatttcggcctgtcgatgagcatgttgagtgataag
ttcaagaaggattggccgtacgatttcggtctcctgtacagtgttacactgagcaagggc
agcctcatcacgtcgctgcaggtccagaataaaggtgcacagccgtttgatttccaggct
ttgctacattcgtacttcagggtcaaggatattaccaaaattcgccttctaaacctgcag
tcagcaacatacgttgacaaactgctcaacgcatcggttcatgtcgaatcctccccggcc
ctctcattcacccaagaaacggatcgcatctatcaatctcttgatccaaccgtgcccatc
atcgttgccgacgcagacaacaacaacagccccatcttctcaattacccgcgaatctctg
aatgatgtcgtggtgtggaacccttggatcgagaaggcgaagggaatggccgatttcgca
cctgatgatggttataagaacatgatttgcgttgaggccggatcagttgcgggatggcag
acgttggaagcaggtgagtcgtgggagggtggccagacagtgaggagtaaactctga

DBGET integrated database retrieval system