KEGG   Paracoccidioides brasiliensis: PAAG_03292Help
Entry
PAAG_03292        CDS       T02230                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pbl  Paracoccidioides brasiliensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 374 aa AA seqDB search
MASVARTFTRGFTRASTANSSSSIRYSTRTSTRFVLPSQAFCTGSRRGYASGPEGEKSSR
SFHIGLGAVVIAGAGALYYLNKDGPKASTKPSGPFTPTKDDYQKVYDEIARLLVENDDYD
DGSYGPVLIRLAWHASGTYDKETGTGGSNGATMRFAPESDHAANAGLKAARDFLEPVKAK
FPWITYSDLWTLAGVCAIQELQGPSIPWRPGRRDKDSTACTPDGRLPDASKNEKHIRAIF
GRMGFDDREIVALCGAHSLGRAHTDRSGYDGPWDFSPTVFTNEFFRMLVNEKWNWRKWNG
PAQFTDKTTHTLMMLPTDIALVKDKEFKKHVERYAKDSETFFKEFSDAFVKLLELGVPFT
SKADDRFVFKTSDS
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgtggcgagaactttcactcggggtttcactcgcgcatccaccgccaactcc
tcttcgtcgatcagatattccactcgcacttcaactcgctttgtcctcccctcccaggcc
ttctgtaccgggtcccgcagaggatatgcttctggtcctgagggtgaaaagtcttctcgc
agcttccacatcggattgggagctgtcgtcattgcaggtgccggtgctctctactacctg
aataaagatggcccgaaagccagcacgaaaccctcaggccccttcacaccaaccaaggat
gattaccagaaagtgtacgatgaaattgcgagactcttagttgaaaatgatgactatgat
gatggtagctatggaccggttctaatccgattggcatggcacgcaagtggtacttatgat
aaggaaactggaactggaggaagcaatggtgccaccatgcgcttcgctcctgagagtgac
cacgctgccaacgctggtttgaaagctgcgagagatttcctcgagccagttaaggcgaag
ttcccctggatcacctactccgatctttggactcttgctggtgtctgcgcaattcaggaa
ttgcagggaccttctatcccatggcgccctggccgccgagacaaggacagcactgcctgc
acccctgacggacgtctccctgatgcttccaagaacgagaagcacatcagagctatcttt
ggacgaatgggctttgacgaccgcgagattgtcgccctctgcggcgctcattctcttggc
cgtgcccatactgaccgatctggttatgatggcccgtgggatttcagcccgactgtcttc
accaacgaattctttaggatgctggtcaatgagaaatggaactggagaaagtggaacggt
ccagcccaattcactgacaagactacccacaccctcatgatgcttcccacagacattgcc
cttgttaaagacaaggagttcaagaagcacgtcgagcgatatgccaaggacagcgaaacc
ttcttcaaggagttctcggatgcattcgtcaagcttctcgagcttggtgtcccattcacc
tctaaagctgacgatcgctttgtgttcaagacctccgacagctaa

DBGET integrated database retrieval system