KEGG   Paracoccidioides lutzii Pb01: PAAG_03551Help
Entry
PAAG_03551        CDS       T02230                                 

Definition
(RefSeq) calcineurin subunit B
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pbl  Paracoccidioides lutzii Pb01
Brite
Protein phosphatases and associated proteins [BR:pbl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     PAAG_03551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 Anthrax-tox_M
Motif
Other DBs
NCBI-GeneID: 9098219
NCBI-ProteinID: XP_002795006
UniProt: C1GXH7
Position
Unknown
AA seq 189 aa AA seqDB search
MAAEPNAAMHEAEQRQQNSGSEVLDNIVSASNFNRDEVDRLRKRFMKLDKDNSGTIERDE
FLSLPQVSSNPLATRMIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEEKLRFAFKVYDID
RDGYISNGELFIVLKMMVGSNLKDMQLQQIVDKTIMEADKDGDGKISFEEFTRMVENTDV
SMSMTLDQF
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggaacccaatgcagccatgcatgaggctgagcagagacagcagaattcaggc
tcagaggttctagataacatagtatcagcttcaaactttaatcgagacgaggttgataga
ctacggaaacgatttatgaagctagataaggataactctggcacgattgagcgcgatgag
tttctttcccttccacaagtatcttcaaacccgcttgcgacacgaatgattgcgattttc
gacgaagatggtggcggtgatgtcgacttccaagaattcgtctcgggcctatcggctttc
agttctaaaggaaataaagaggagaagctgcgcttcgcctttaaggtctacgatattgac
cgtgacgggtacatttcgaacggggaactgttcatcgtgctgaagatgatggtgggaagc
aatttaaaggacatgcaacttcagcagattgtggataagacgattatggaggcggataag
gatggcgatgggaagattagctttgaggaatttacgcgcatggtggaaaatacggatgtc
agcatgagtatgactttggatcaattctga

DBGET integrated database retrieval system