KEGG   Paracoccidioides brasiliensis: PAAG_03551Help
Entry
PAAG_03551        CDS       T02230                                 

Definition
calcineurin subunit B
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pbl  Paracoccidioides brasiliensis
Brite
Protein phosphatases and associated proteins [BR:pbl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     PAAG_03551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 189 aa AA seqDB search
MAAEPNAAMHEAEQRQQNSGSEVLDNIVSASNFNRDEVDRLRKRFMKLDKDNSGTIERDE
FLSLPQVSSNPLATRMIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEEKLRFAFKVYDID
RDGYISNGELFIVLKMMVGSNLKDMQLQQIVDKTIMEADKDGDGKISFEEFTRMVENTDV
SMSMTLDQF
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggaacccaatgcagccatgcatgaggctgagcagagacagcagaattcaggc
tcagaggttctagataacatagtatcagcttcaaactttaatcgagacgaggttgataga
ctacggaaacgatttatgaagctagataaggataactctggcacgattgagcgcgatgag
tttctttcccttccacaagtatcttcaaacccgcttgcgacacgaatgattgcgattttc
gacgaagatggtggcggtgatgtcgacttccaagaattcgtctcgggcctatcggctttc
agttctaaaggaaataaagaggagaagctgcgcttcgcctttaaggtctacgatattgac
cgtgacgggtacatttcgaacggggaactgttcatcgtgctgaagatgatggtgggaagc
aatttaaaggacatgcaacttcagcagattgtggataagacgattatggaggcggataag
gatggcgatgggaagattagctttgaggaatttacgcgcatggtggaaaatacggatgtc
agcatgagtatgactttggatcaattctga

DBGET integrated database retrieval system