KEGG   Paracoccidioides brasiliensis: PAAG_03569Help
Entry
PAAG_03569        CDS       T02230                                 

Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PAAG_03569
Enzymes [BR:pbl01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     PAAG_03569
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     PAAG_03569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 178 aa AA seqDB search
MKAYWYDNQPGDQRLPHDSGHAVDPAYLATVGVLYRHFPTVDDVDALAKERGYKNRDEIV
VSPEKMGAVYEEKVKMFFHEHLHEDEEIRYILDGEGFFDVRSKDDEWVRIRLGKGDLVIL
PAGIYHRFTTDENNYVKAMRLFQDEPKWTPLNRDPELETNKHRKAYVETLISRQPVAT
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcatactggtacgataaccaaccaggtgaccaacggctcccgcacgactccggc
catgccgttgaccctgcatacctcgccactgtaggcgtactctaccggcacttccccacc
gtagatgacgtagatgccctggccaaggaacgcggctacaagaaccgtgatgagatcgtc
gtttcccccgagaaaatgggtgcggtgtacgaggagaaagtgaagatgtttttccacgag
catctgcatgaggatgaggagattcggtatatacttgatggggaggggttttttgatgtg
cggagcaaggatgatgagtgggttcgtattcggctagggaagggggatttggtcattctg
ccggcggggatttatcatcgatttacaacagatgagaataattacgtcaaagccatgcgt
ctcttccaagacgaacctaaatggactcctctaaaccgtgatccggaactcgaaacaaat
aaacatcgcaaagcatacgtcgagaccctcatttcccgtcaaccagttgccacctga

DBGET integrated database retrieval system