KEGG   Paracoccidioides brasiliensis: PAAG_03970Help
Entry
PAAG_03970        CDS       T02230                                 

Definition
replication factor-A protein
Orthology
K10739  
replication factor A2
Organism
pbl  Paracoccidioides brasiliensis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:pbl03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:pbl03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:pbl03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pbl03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 285 aa AA seqDB search
MDYDYGNQYTSTTSYGAQGGMGGGGFTGGEGGSQSDSKGGGYGKSSLRPVTIKQTQDASQ
THGDTDFKISGTEVSQIVFVGQVRAISHLTTFVTYKLDDGTGEIEVKLWLEKNAVNPTGD
EMEARDAAHPSESEIQVNGYAKVWGKLNNFNNRRNFVAHVIRPITNMNEYHCHFLEATAI
HLYYTRGPPGEQQGDKPVAGAAPAVGGGGSSTFAGRVLPPMSPLARKVYETLSETPQSNE
GLHVQNLAALMGLSAGEVFKGGEELLSNGLIFPTVDDNTWAILEY
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggactacgattacggcaaccagtacacatctaccacctcgtatggcgcccaaggtggg
atgggcggagggggtttcacaggaggtgaaggaggcagtcaatcagactccaaaggagga
ggctatggtaaaagctcactccggcccgtgacgataaagcagacccaggatgccagtcaa
acacacggggacacagatttcaaaatatctggcacagaggtgtctcagattgtcttcgtc
ggccaggtccgcgccatcagccacctcacaacatttgtcacatacaaactagacgacggc
accggagaaatcgaagttaaattatggctcgaaaagaacgctgtgaatcccacgggagac
gagatggaagcgagagatgctgcacacccatcggaatcggaaatccaggtcaatggatat
gccaaagtttggggcaagcttaacaatttcaacaatcggcgcaatttcgtcgcacatgtt
atccggcccataacgaatatgaatgaatatcattgtcatttcctcgaagctacagctata
catctttattatacgcggggtccaccgggagaacagcaaggggacaaaccagtggctgga
gcagcacctgctgttggtggaggcgggagttcaactttcgccggaagggtattgcctcca
atgtcaccattggcgcggaaggtgtacgagactttaagtgaaactccacagagcaatgag
ggcctccatgtacagaatctggcggcgctaatggggttatctgccggggaagtgtttaag
ggaggtgaagaacttttgagcaacggattgatattcccgactgtagatgacaacacctgg
gcaattctagagtattga

DBGET integrated database retrieval system