KEGG   Paracoccidioides lutzii Pb01: PAAG_03970Help
Entry
PAAG_03970        CDS       T02230                                 

Definition
(RefSeq) replication factor-A protein
  KO
K10739  
replication factor A2
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PAAG_03970
   03420 Nucleotide excision repair
    PAAG_03970
   03430 Mismatch repair
    PAAG_03970
   03440 Homologous recombination
    PAAG_03970
DNA replication proteins [BR:pbl03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    PAAG_03970
DNA repair and recombination proteins [BR:pbl03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     PAAG_03970
   MMR (mismatch exicision repair)
     PAAG_03970
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     PAAG_03970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
AA seq 285 aa AA seqDB search
MDYDYGNQYTSTTSYGAQGGMGGGGFTGGEGGSQSDSKGGGYGKSSLRPVTIKQTQDASQ
THGDTDFKISGTEVSQIVFVGQVRAISHLTTFVTYKLDDGTGEIEVKLWLEKNAVNPTGD
EMEARDAAHPSESEIQVNGYAKVWGKLNNFNNRRNFVAHVIRPITNMNEYHCHFLEATAI
HLYYTRGPPGEQQGDKPVAGAAPAVGGGGSSTFAGRVLPPMSPLARKVYETLSETPQSNE
GLHVQNLAALMGLSAGEVFKGGEELLSNGLIFPTVDDNTWAILEY
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggactacgattacggcaaccagtacacatctaccacctcgtatggcgcccaaggtggg
atgggcggagggggtttcacaggaggtgaaggaggcagtcaatcagactccaaaggagga
ggctatggtaaaagctcactccggcccgtgacgataaagcagacccaggatgccagtcaa
acacacggggacacagatttcaaaatatctggcacagaggtgtctcagattgtcttcgtc
ggccaggtccgcgccatcagccacctcacaacatttgtcacatacaaactagacgacggc
accggagaaatcgaagttaaattatggctcgaaaagaacgctgtgaatcccacgggagac
gagatggaagcgagagatgctgcacacccatcggaatcggaaatccaggtcaatggatat
gccaaagtttggggcaagcttaacaatttcaacaatcggcgcaatttcgtcgcacatgtt
atccggcccataacgaatatgaatgaatatcattgtcatttcctcgaagctacagctata
catctttattatacgcggggtccaccgggagaacagcaaggggacaaaccagtggctgga
gcagcacctgctgttggtggaggcgggagttcaactttcgccggaagggtattgcctcca
atgtcaccattggcgcggaaggtgtacgagactttaagtgaaactccacagagcaatgag
ggcctccatgtacagaatctggcggcgctaatggggttatctgccggggaagtgtttaag
ggaggtgaagaacttttgagcaacggattgatattcccgactgtagatgacaacacctgg
gcaattctagagtattga

DBGET integrated database retrieval system