KEGG   Paracoccidioides brasiliensis: PAAG_03970Help
Entry
PAAG_03970        CDS       T02230                                 

Definition
replication factor-A protein
Orthology
K10739  
replication factor A2
Organism
pbl  Paracoccidioides brasiliensis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PAAG_03970
   03420 Nucleotide excision repair
    PAAG_03970
   03430 Mismatch repair
    PAAG_03970
   03440 Homologous recombination
    PAAG_03970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 285 aa AA seqDB search
MDYDYGNQYTSTTSYGAQGGMGGGGFTGGEGGSQSDSKGGGYGKSSLRPVTIKQTQDASQ
THGDTDFKISGTEVSQIVFVGQVRAISHLTTFVTYKLDDGTGEIEVKLWLEKNAVNPTGD
EMEARDAAHPSESEIQVNGYAKVWGKLNNFNNRRNFVAHVIRPITNMNEYHCHFLEATAI
HLYYTRGPPGEQQGDKPVAGAAPAVGGGGSSTFAGRVLPPMSPLARKVYETLSETPQSNE
GLHVQNLAALMGLSAGEVFKGGEELLSNGLIFPTVDDNTWAILEY
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggactacgattacggcaaccagtacacatctaccacctcgtatggcgcccaaggtggg
atgggcggagggggtttcacaggaggtgaaggaggcagtcaatcagactccaaaggagga
ggctatggtaaaagctcactccggcccgtgacgataaagcagacccaggatgccagtcaa
acacacggggacacagatttcaaaatatctggcacagaggtgtctcagattgtcttcgtc
ggccaggtccgcgccatcagccacctcacaacatttgtcacatacaaactagacgacggc
accggagaaatcgaagttaaattatggctcgaaaagaacgctgtgaatcccacgggagac
gagatggaagcgagagatgctgcacacccatcggaatcggaaatccaggtcaatggatat
gccaaagtttggggcaagcttaacaatttcaacaatcggcgcaatttcgtcgcacatgtt
atccggcccataacgaatatgaatgaatatcattgtcatttcctcgaagctacagctata
catctttattatacgcggggtccaccgggagaacagcaaggggacaaaccagtggctgga
gcagcacctgctgttggtggaggcgggagttcaactttcgccggaagggtattgcctcca
atgtcaccattggcgcggaaggtgtacgagactttaagtgaaactccacagagcaatgag
ggcctccatgtacagaatctggcggcgctaatggggttatctgccggggaagtgtttaag
ggaggtgaagaacttttgagcaacggattgatattcccgactgtagatgacaacacctgg
gcaattctagagtattga

DBGET integrated database retrieval system