KEGG   Paracoccidioides lutzii Pb01: PAAG_11783Help
Entry
PAAG_11783        CDS       T02230                                 

Gene name
PAAG_03974
Definition
(RefSeq) NADPH-cytochrome P450 reductase
  KO
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pbl  Paracoccidioides lutzii Pb01
Brite
Enzymes [BR:pbl01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     PAAG_11783 (PAAG_03974)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 536 aa AA seqDB search
MTQVDTLDLVVLVVILVGSVAYFTKGSLWGVVKDPYATAYSNANGAKAGASRDIIEKLDE
TGKNCVIFYGSQTGTAEDYASRLAKEGSQRFGLKTMVADLEDYDYENLDKFPEDKVMFFV
LATYGEGEPTDNAVDFYQFITSDDVSFEGGGTSDDKPLSSIRYVAFGLGNNTYEHYNSMV
RNVDATMKRLGAKRIGEAGEGDDGAGTMEEDYLAWKEPMWKALAEEMGLEEREAVYEPVF
SVIEEPETSPEADHIASQYMNIAQALQSVTPLPFTSVPFSLLIEGIPKIQPRYYSISSSS
LVQKNKISITAIVESLRIPGATHNLKGVTTNYLLALKQKQHGDPNPDPHGLTYAINGPRN
KYDGIHVPIHVRHSNFKLPSDPAKPVIMVGPGTGVAPFRGFIQERAAQAERGDKVGPTIL
FYGCRRREEDFLYKDEWDTFASKLGSSLQIITAFSRETSQKVYVQHKLREHAELVNELLL
QKGNFYVCGDAANMAREVNVVLGQIMAEQRGLAPEKGEELVKHMRNNGSYQEDVWS
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggtcgacacattggacctggtggtcctggtcgtaattcttgtgggtagcgtc
gcctattttactaagggctctttatggggtgttgttaaggacccctatgcgacagcttat
tcgaacgcaaatggcgcaaaggccggggcatcaagagacatcatcgagaaactagacgag
actggaaaaaattgtgtgatcttctacggttcccagaccggaaccgcggaggactatgcc
tcgcggttggccaaggagggctcccaacgatttggcctcaaaaccatggtggccgattta
gaagattatgattacgagaatctcgacaagttcccagaggataaggtcatgttttttgtg
ctcgcgacttacggtgagggtgagcctacggataacgccgtggatttctatcagttcatt
acttcagacgacgtttcgttcgaaggtggtggaacgtctgatgataagcctctttcctcc
attaggtatgtcgcctttggcctgggaaacaacacctatgagcattataactcgatggtg
agaaatgtcgatgctacgatgaagaggctcggcgccaaacgaattggagaggccggtgaa
ggtgatgatggtgcaggtaccatggaagaggattatctggcctggaaagagcccatgtgg
aaagctctggcagaggaaatggggctggaggaacgggaagctgtttacgaacccgtattc
tcagttatcgaggaaccggaaacctcccctgaagccgaccatatcgctagccaatacatg
aacatcgcccaggcactacaatccgttacgccgctcccatttacctccgtccccttctcc
ctgttaatcgaaggcatcccaaaaatccaaccgcgctactactccatctcctcctcctcc
ctcgtccaaaagaacaaaatcagcatcaccgccattgtcgaatccctacgcatccccggc
gcaacccacaacctcaagggcgtcacaacaaactacctgctcgccttgaagcagaaacaa
cacggcgaccccaatccggacccgcacggattgacatacgccatcaacgggcccagaaac
aagtacgacggcatccacgtcccaatccacgtgcggcattccaacttcaaactcccctcc
gacccggccaagccggtcattatggtcgggccgggaacgggtgttgcgccgttccgcggg
tttatacaggagcgcgcggcgcaggcggagaggggggataaggtagggcccacgattttg
ttctatggatgtcgacgacgggaggaggatttcctgtataaagatgagtgggataccttc
gcctcaaagctcggctcaagcctgcaaatcatcaccgccttctcgcgcgaaacctctcaa
aaagtctatgtccaacacaagctacgcgaacacgctgagctcgtcaatgagctgctgttg
caaaagggaaacttctacgtctgtggcgatgcggccaatatggcgcgggaggtgaatgtg
gtgctggggcagattatggcggagcagcgcgggctggcgccggagaagggcgaggagttg
gttaagcatatgcggaacaatgggtcatatcaggaagatgtttggtcgtga

DBGET integrated database retrieval system