KEGG   Paracoccidioides brasiliensis: PAAG_04050Help
Entry
PAAG_04050        CDS       T02230                                 

Definition
serine/threonine-protein kinase PRKX
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:pbl04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 400 aa AA seqDB search
MAAETIQGQSSTSYRPETDVPAESTRDIDTVNKKQQQHQQQPQKKSNAEKPNSLDLSLGL
DLACPASRPETPQDILENRERIRQRLPAERLSIDDFDLLETVGTGTFARVWLARWAKRKE
GQDGVEHVRNEVRTLAAVSGHPFIISLISTFSDDQNLYMLLDYCPGGEVFTFLRRARCFS
ERTSQFYAAEIVLILEFLHEVHGVAYRDLKPENILLDAEGHLKLVDFGFAKQLWSRETYT
LCGTPEYLAPEVIHNSGHGLAVDWWALGVLIYEFIVGQPPFWDQNPMRIYEQIVQGRLRF
PVNMPPAVRDIVSQLCTTNPSERLGYIKGGAARVKQHPFFKDINWDDIYFRRTKGPIVPR
VDSPTDTGNFEEYPDEPDSSLLTPYTKEMREKHDDMFADF
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggaaacgatacaagggcagtcatcaacatcctaccggccagaaactgatgta
cccgccgagtcaacgcgcgatatcgacacggtgaataagaagcagcagcaacaccaacaa
cagccccagaagaagagtaacgctgagaagccaaatagcctggatctgagcctgggcctg
gatctggcctgtcccgcatcgcgcccggaaaccccgcaagacatccttgagaatcgggag
aggattcgacaacggctacctgcggagcggctgagcattgatgattttgaccttctcgaa
actgtagggacaggtacatttgctcgagtttggctggctcggtgggcgaagaggaaagaa
ggccaggatggagttgagcatgtgcggaatgaagtcagaacccttgctgcggtttctggc
cacccgtttatcatttcccttatttccactttctccgacgatcaaaatttatacatgttg
ctagactactgcccaggcggcgaagtcttcacatttctccgccgcgcccgctgcttcagc
gagcgaacctcccaattctacgccgccgaaatcgtcctaatcctcgaattcctccacgaa
gtccacggcgtcgcataccgcgacctcaagcccgaaaacatcctcctagacgcagagggc
cacctcaaactcgtcgacttcggcttcgccaaacaactctggagcagagaaacatacacc
ctctgcggcaccccagaataccttgcaccagaagtcatccacaacagcggccacggccta
gcggttgactggtgggctctaggcgtccttatatatgagttcatagtcggacagccacca
ttctgggaccagaatcccatgcgcatatacgagcagatcgttcagggacgtctgcggttc
cccgtaaacatgccccccgccgtccgcgatattgtgtcccagctctgcacgacgaaccct
tcggagcggctagggtatatcaaaggtggtgcagcgcgagtgaagcagcacccgtttttc
aaggatatcaattgggatgacatttattttcggcggaccaaggggcctatagtccccagg
gtggattcgccgactgacacgggcaattttgaggaatacccggacgagccggattcgtcg
ttgcttacaccctatacgaaggagatgcgagagaagcatgatgatatgtttgcagatttt
tga

DBGET integrated database retrieval system