KEGG   Paracoccidioides brasiliensis: PAAG_04050Help
Entry
PAAG_04050        CDS       T02230                                 

Definition
serine/threonine-protein kinase PRKX
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Meiosis - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    PAAG_04050
Enzymes [BR:pbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PAAG_04050
Protein kinases [BR:pbl01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   PAAG_04050
Messenger RNA biogenesis [BR:pbl03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     PAAG_04050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 400 aa AA seqDB search
MAAETIQGQSSTSYRPETDVPAESTRDIDTVNKKQQQHQQQPQKKSNAEKPNSLDLSLGL
DLACPASRPETPQDILENRERIRQRLPAERLSIDDFDLLETVGTGTFARVWLARWAKRKE
GQDGVEHVRNEVRTLAAVSGHPFIISLISTFSDDQNLYMLLDYCPGGEVFTFLRRARCFS
ERTSQFYAAEIVLILEFLHEVHGVAYRDLKPENILLDAEGHLKLVDFGFAKQLWSRETYT
LCGTPEYLAPEVIHNSGHGLAVDWWALGVLIYEFIVGQPPFWDQNPMRIYEQIVQGRLRF
PVNMPPAVRDIVSQLCTTNPSERLGYIKGGAARVKQHPFFKDINWDDIYFRRTKGPIVPR
VDSPTDTGNFEEYPDEPDSSLLTPYTKEMREKHDDMFADF
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggaaacgatacaagggcagtcatcaacatcctaccggccagaaactgatgta
cccgccgagtcaacgcgcgatatcgacacggtgaataagaagcagcagcaacaccaacaa
cagccccagaagaagagtaacgctgagaagccaaatagcctggatctgagcctgggcctg
gatctggcctgtcccgcatcgcgcccggaaaccccgcaagacatccttgagaatcgggag
aggattcgacaacggctacctgcggagcggctgagcattgatgattttgaccttctcgaa
actgtagggacaggtacatttgctcgagtttggctggctcggtgggcgaagaggaaagaa
ggccaggatggagttgagcatgtgcggaatgaagtcagaacccttgctgcggtttctggc
cacccgtttatcatttcccttatttccactttctccgacgatcaaaatttatacatgttg
ctagactactgcccaggcggcgaagtcttcacatttctccgccgcgcccgctgcttcagc
gagcgaacctcccaattctacgccgccgaaatcgtcctaatcctcgaattcctccacgaa
gtccacggcgtcgcataccgcgacctcaagcccgaaaacatcctcctagacgcagagggc
cacctcaaactcgtcgacttcggcttcgccaaacaactctggagcagagaaacatacacc
ctctgcggcaccccagaataccttgcaccagaagtcatccacaacagcggccacggccta
gcggttgactggtgggctctaggcgtccttatatatgagttcatagtcggacagccacca
ttctgggaccagaatcccatgcgcatatacgagcagatcgttcagggacgtctgcggttc
cccgtaaacatgccccccgccgtccgcgatattgtgtcccagctctgcacgacgaaccct
tcggagcggctagggtatatcaaaggtggtgcagcgcgagtgaagcagcacccgtttttc
aaggatatcaattgggatgacatttattttcggcggaccaaggggcctatagtccccagg
gtggattcgccgactgacacgggcaattttgaggaatacccggacgagccggattcgtcg
ttgcttacaccctatacgaaggagatgcgagagaagcatgatgatatgtttgcagatttt
tga

DBGET integrated database retrieval system