KEGG   Paracoccidioides lutzii Pb01: PAAG_04050Help
Entry
PAAG_04050        CDS       T02230                                 

Definition
(RefSeq) serine/threonine-protein kinase PRKX
Organism
pbl  Paracoccidioides lutzii Pb01
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 417 aa AA seqDB search
MAAETIQGQSSTSYRPETDVPAESTRDIDTVNKKQQQHQQQPQKKSNAEKPNSLDLSLGL
DLACPASRPETPQDILENRERIRQRLPAERLSIDDFDLLETVGTGTFARVWLARWAKRKE
GQDGVYAIKILHKADVIKLKQVEHVRNEVRTLAAVSGHPFIISLISTFSDDQNLYMLLDY
CPGGEVFTFLRRARCFSERTSQFYAAEIVLILEFLHEVHGVAYRDLKPENILLDAEGHLK
LVDFGFAKQLWSRETYTLCGTPEYLAPEVIHNSGHGLAVDWWALGVLIYEFIVGQPPFWD
QNPMRIYEQIVQGRLRFPVNMPPAVRDIVSQLCTTNPSERLGYIKGGAARVKQHPFFKDI
NWDDIYFRRTKGPIVPRVDSPTDTGNFEEYPDEPDSSLLTPYTKEMREKHDDMFADF
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggaaacgatacaagggcagtcatcaacatcctaccggccagaaactgatgta
cccgccgagtcaacgcgcgatatcgacacggtgaataagaagcagcagcaacaccaacaa
cagccccagaagaagagtaacgctgagaagccaaatagcctggatctgagcctgggcctg
gatctggcctgtcccgcatcgcgcccggaaaccccgcaagacatccttgagaatcgggag
aggattcgacaacggctacctgcggagcggctgagcattgatgattttgaccttctcgaa
actgtagggacaggtacatttgctcgagtttggctggctcggtgggcgaagaggaaagaa
ggccaggatggagtatatgcgattaagattttgcataaggcggacgtaatcaaactaaaa
caggttgagcatgtgcggaatgaagtcagaacccttgctgcggtttctggccacccgttt
atcatttcccttatttccactttctccgacgatcaaaatttatacatgttgctagactac
tgcccaggcggcgaagtcttcacatttctccgccgcgcccgctgcttcagcgagcgaacc
tcccaattctacgccgccgaaatcgtcctaatcctcgaattcctccacgaagtccacggc
gtcgcataccgcgacctcaagcccgaaaacatcctcctagacgcagagggccacctcaaa
ctcgtcgacttcggcttcgccaaacaactctggagcagagaaacatacaccctctgcggc
accccagaataccttgcaccagaagtcatccacaacagcggccacggcctagcggttgac
tggtgggctctaggcgtccttatatatgagttcatagtcggacagccaccattctgggac
cagaatcccatgcgcatatacgagcagatcgttcagggacgtctgcggttccccgtaaac
atgccccccgccgtccgcgatattgtgtcccagctctgcacgacgaacccttcggagcgg
ctagggtatatcaaaggtggtgcagcgcgagtgaagcagcacccgtttttcaaggatatc
aattgggatgacatttattttcggcggaccaaggggcctatagtccccagggtggattcg
ccgactgacacgggcaattttgaggaatacccggacgagccggattcgtcgttgcttaca
ccctatacgaaggagatgcgagagaagcatgatgatatgtttgcagatttttga

DBGET integrated database retrieval system