KEGG   Paracoccidioides brasiliensis: PAAG_04327Help
Entry
PAAG_04327        CDS       T02230                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
pbl  Paracoccidioides brasiliensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1121 aa AA seqDB search
MDDSCEDAADLPFQLGDLQLTDNDMVVDDYDQYPSDRADVVVVSPPGSASEPEPEPLATD
YEAMMAKVLPENPDLETEAQTYNTWNIENWTKLRRKEHGPIFECGGAPWCVPRANPIPHA
VYAELRKRLLRAYTLTLEVLSRRVLFFPFGNGVDHASFYLEHGFENPPPDNWYACVQFAL
VLSNKNDPSIYITHSAHHRFNADEADWGFTRFCELRKLFQQAFNDKGTPLVENEEACLTA
YVRVVKDPTGVLWHSFQNYDSKKETGMVGLRNQGATCYLNSLLQSLFFTNSFRKAVYQIP
TEQDANKSNSAWTLQRLFYHLQTSDVPVSTAELTSSFGWESRHTFEQQDVQELSRLLMDK
LEGQMKGTPAEKALPELFVGKTKTYISCIHVDYESSRIEDFWDIQLNVRGNRTLDDSFKD
YIQVETLEGENKYDAGEPYKLQEAKKGVIFESFPPVLHLHLKRFEYDINRDAMMKINDRL
EFPEEFDAAPYLSDDADKSEPWVYQLHGVLVHSGDFNAGHYYAYLRPTKDGMFYKFDDDK
VIRATMKETLEENFGGEYPNVANGTTGVRQPYMRGYSMKRSMNAYMLVYIRKSRVNDVLV
DVVKEDIPAHLARKKKEREEQHLYMNIGLLSDESFKAHHGFDLTSLDLEPDDPAAAKLYR
VLRTKKVGEFVAEFAEEKGLQPDQVRLWVMVNRQNKTTRPDQPLKDLDMSVEEAFSRYGT
KGSQFRLFIEVGELGADGKATWPETQGSNATSLVFLKHFDVVQQTLTGVGHVFVRKHSKV
SDLAGPILELMNWPAGTPFILFEEIKHSMIEPMKSKQTFHQSEIQDGDIICFQRQVSDSD
RKMTYEQWTSKVGEHLKIDPTHIRFAPVLQNSGKPKPFIKRNATQNLQQILTSQYSPYGY
SVHRPDALYYEVLETSLSEYETKKMVKVTWLPEGISKEQPYDILVAKNGNISDLILGFQK
RANLDDETAQHLRVYEVYGGKVYKELPENYSILSITDYVTLYIERIPQEELNMQEGEYKI
DCFNFDKEPNKTHGVPFRFVVKPGEIFKETKERLSKRTGIRGKQFEKIKFAMALRQGFCN
PRYIDDDDILSDLAAEPQDVLGLDHVNKNRSFWKSEGFFIR
NT seq 3366 nt NT seq  +upstreamnt  +downstreamnt
atggatgacagctgtgaggatgccgctgacctgccctttcaactgggcgatctgcagctt
acggacaatgatatggttgtcgacgactacgaccagtaccccagtgaccgcgcggatgtt
gtcgtcgtgtctcctcccggctccgccagcgaacctgaaccggagcctctagctactgac
tatgaggcgatgatggcaaaagtcttgccggaaaacccagatttggaaacagaagcacaa
acgtataatacatggaatatcgagaactggacaaagctgcggcggaaagaacatggcccg
atttttgagtgtggaggagctccatggtgcgttccccgtgccaatcctatacctcatgcg
gtttatgcggagcttcgtaagcgactgctcagagcatatactctaacacttgaagtgtta
tctaggcgggttttgttcttcccattcgggaacggcgtcgaccatgcatccttttacctt
gaacacggcttcgagaacccccctccggataattggtatgcatgtgtgcagtttgcgttg
gtcctgtcgaataagaatgatccttcaatatatattacgcactcggcacaccaccgtttc
aatgcagatgaggcagactgggggtttacacggttttgcgaactccggaagttattccag
caggcctttaacgataaaggaaccccgcttgttgagaatgaagaagcctgtctcacagct
tatgtccgcgtggtgaaagatccaacgggggttctgtggcacagcttccaaaactatgac
tcgaagaaggaaacaggaatggtaggcctaagaaatcagggtgctacttgctatctcaac
tcattgctccagtctctgttctttacgaactcgttccgaaaggctgtttatcaaataccc
accgaacaagacgccaacaagtcaaattcagcatggactcttcaacgactattttaccac
cttcaaaccagcgacgttccggtatcgacggctgaactcacatcttcctttggttgggaa
tcgagacatacctttgagcagcaggatgtccaagaactttcaagattattgatggataaa
ctcgaagggcagatgaagggcacccctgctgaaaaagcacttcctgaactatttgttgga
aagacaaaaacgtacatatcttgcattcatgttgactatgagtcgtccaggatagaagac
ttttgggatatccaactgaacgtccggggcaataggaccctggatgacagtttcaaagat
tacatccaggttgaaacgttggaaggagaaaataagtatgacgctggagaaccctataag
cttcaggaggccaaaaagggtgtgatatttgagagcttcccgcccgtcctccacctgcat
ctcaaacggttcgaatatgacatcaatcgcgacgccatgatgaaaatcaacgacagactt
gaattcccagaggaatttgacgcggcaccatatctatcggatgatgcagataaatcagag
ccatgggtctaccaactacacggtgtccttgtgcatagtggcgacttcaatgccggccac
tactacgcatatcttcgaccaacaaaggatggcatgttctataagtttgatgatgacaag
gttattcgcgcaaccatgaaggaaactcttgaggaaaattttggtggagaatatcccaac
gtcgccaatggtacaacgggagttcgacagccatatatgcgaggctattccatgaagcga
tcaatgaatgcgtacatgttggtgtacatcagaaaatctcgagtaaatgacgttcttgtt
gacgttgtgaaagaagatatacccgcacaccttgcacgaaagaaaaaggagcgggaggag
caacatctctatatgaacatcgggttgctgtctgatgagtcgttcaaggcccatcatgga
ttcgatttgaccagtctggatttggagcctgacgaccccgctgccgcgaaattgtaccgt
gttctcaggactaagaaagttggcgagtttgtggctgaatttgctgaagaaaagggattg
caacccgaccaagtgagactttgggtaatggtgaacaggcaaaataaaaccactcgccca
gatcaacctctgaaggatcttgatatgtctgtcgaagaggcgtttagtcgatacggtaca
aagggaagtcagttccgactgtttatcgaagtaggagaactcggagccgacggcaaagca
acttggcccgaaactcagggcagtaatgcgaccagccttgttttcttgaagcacttcgat
gttgttcagcagactttgactggtgttgggcacgttttcgttcggaaacattctaaggtc
tcagacctggctggtccaattctggaattgatgaactggcctgctgggacccctttcata
ttatttgaggaaataaaacactcgatgatcgaaccgatgaaatccaagcagactttccac
caatcagaaatacaagacggagacattatctgcttccagcgccaagtcagcgattctgac
cgtaaaatgacatacgaacaatggacgtcaaaagttggcgaacatttaaagattgacccg
actcatatacggtttgcgcccgtgctccagaacagcgggaagcccaaaccattcattaag
cggaatgcgacacagaacctccagcagatcctgacgagtcagtattcgccttatggatac
agtgttcatcggccggacgctctttattatgaggttctcgaaactagtttgagtgaatat
gaaacaaagaagatggttaaggtcacctggcttcctgaggggatttctaaggagcaacca
tacgatatcctcgttgcgaagaacggcaatatctctgatctgattttgggcttccaaaaa
cgggccaacctcgacgatgagactgcacaacacctgcgcgtttatgaagtttatggcggg
aaggtgtataaggagctccccgagaactacagcatacttagcattacagattatgtgact
ctttatattgagaggataccacaggaagaacttaatatgcaagaaggagaatacaaaatc
gattgcttcaatttcgacaaggagccgaataaaacacatggcgttccattcagattcgtt
gttaagccaggcgagatcttcaaagagaccaaggagcgactctcgaaaagaacaggaatt
cgaggcaagcaatttgagaagatcaagtttgctatggcccttcgtcaaggattttgtaat
ccaagatatatcgacgatgacgatatactctcagatttggccgctgaaccacaagatgtg
ctcggcctcgaccatgtaaataaaaacagaagtttctggaagagtgagggattctttatc
cgatag

DBGET integrated database retrieval system