KEGG   Paracoccidioides brasiliensis: PAAG_04343Help
Entry
PAAG_04343        CDS       T02230                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PAAG_04343
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PAAG_04343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 347 aa AA seqDB search
MPGDSTPFGPKPKSSVPSYLLNGTASICVPSNVQEREILHSSIKSSFSRRQVIDPELPSE
PPLPSPATATGLSIVRDAVTPATAINGAPDTDNPYGRVNGIPVNEGGKPNANQNEHEHDN
ESEDHVGRPIEAPVILNAAPISSGTNFSGEPPRDPTDHTRPLTPPSTTSRSESPYTVNPP
IDFDGLSWPSVGTRKRLDSSPEESEKRMQKLADAVRTILECIGEDPQREGLLGTPERYAK
ALMYFTKGYEENVRDQVNGAVFHEDHDELVIVKDIEVFSLCEHHMVPFTGKPVITLSHTS
KNREDKGKNNPIQQMHIGYIPNRRVLGLSKLVRLAEMFSAASRSKNG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcccggagactccacaccattcgggcccaagcccaaatcctcagtcccatcctacctc
ctaaatggaactgcatccatttgcgtgccaagcaatgtgcaagagcgcgagatcctccat
tcctccatcaaatcttccttctcccggagacaggtcattgatccagagcttccttcagaa
ccaccattaccatcacctgctactgccacagggttatcaattgtgcgggatgcagtgact
ccagcaactgctataaatggcgctccagatactgacaacccctatggtcgagttaacggc
atacctgtgaatgagggtggaaagcccaatgccaatcagaatgagcatgagcatgacaat
gagagtgaagaccatgttggtagaccgatagaagcgcctgtcattttgaatgccgcccca
atttcttccggaacaaatttcagcggtgaacccccgcgtgatcctacggatcatacgaga
cccttaacgcctccttccactaccagccggtctgagagcccgtacacagtaaacccgcca
attgattttgacggacttagttggccgagtgttggtacccgcaaacgcctagactcatca
cccgaagaaagcgaaaagcgcatgcagaaactcgcagacgccgtgcggacaattttagaa
tgtatcggagaagacccccagcgggaagggttgctaggcacgccggagagatatgccaag
gctctgatgtatttcacgaaggggtatgaggagaacgtacgcgatcaggtgaacggcgct
gttttccatgaggaccatgacgagctggttattgtgaaggacatcgaggtgttttcgctt
tgcgaacatcatatggtgccgtttacggggaagcccgtgatcaccctatcccatacatcc
aaaaacagagaagacaagggcaaaaataaccccatacaacagatgcacatcggctacatc
ccgaatcgccgcgtcctaggcctctccaaactcgtcaggctggcagagatgttctccgcc
gcctccaggtccaagaacggctga

DBGET integrated database retrieval system