KEGG   Paracoccidioides brasiliensis: PAAG_04424Help
Entry
PAAG_04424        CDS       T02230                                 

Definition
peroxiredoxin HYR1
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PAAG_04424
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PAAG_04424
Enzymes [BR:pbl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PAAG_04424
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 202 aa AA seqDB search
MSSATSFYDFQPLDKKGEPFPLTGLKGKVVLIVNTASKCGFTPQFKGLESLYTSLSTTYP
GKFTIIGFPCNQFGSQEPGTNDEIQSFCSANYGVTFPVLSKVDVNGENAAPLWKWLKSEM
PGIMGMKRVKWNFEKFLVSADGKVVHRWASFTKPESLRHAIEKEIHKAEGQPAEQEPATE
VPTVKPEEQRPEASQPSQPSQL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctgccacttctttctacgacttccagccgctagacaaaaagggcgaacccttc
cccctgactggcctcaaaggcaaagtcgtcctcatcgttaacaccgcctccaaatgcggc
ttcactccacaattcaagggtctcgaatccctctacacctccctctcgactacctaccct
ggtaaattcaccatcatcggctttccctgcaaccaattcggctcgcaggagccaggaacc
aatgacgaaatccaatccttttgctccgccaactacggcgtcacgttccctgtcctgagc
aaagtcgacgtgaacggcgaaaacgcggcccctctgtggaaatggctcaagtctgagatg
cccggtatcatgggcatgaagcgtgtgaagtggaactttgagaagtttttggtcagtgcg
gatggaaaggttgtccatcgttgggcgagctttacgaagcctgagtcgctgagacatgcg
attgagaaggagatccataaggccgagggacaacctgcggaacaggaaccagctaccgag
gttccgacggtgaaacctgaagagcaacgtcctgaggcttcacaaccttctcagccttcg
cagctgtga

DBGET integrated database retrieval system