KEGG   Paracoccidioides brasiliensis: PAAG_04424Help
Entry
PAAG_04424        CDS       T02230                                 

Definition
peroxiredoxin HYR1
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pbl00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pbl00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 202 aa AA seqDB search
MSSATSFYDFQPLDKKGEPFPLTGLKGKVVLIVNTASKCGFTPQFKGLESLYTSLSTTYP
GKFTIIGFPCNQFGSQEPGTNDEIQSFCSANYGVTFPVLSKVDVNGENAAPLWKWLKSEM
PGIMGMKRVKWNFEKFLVSADGKVVHRWASFTKPESLRHAIEKEIHKAEGQPAEQEPATE
VPTVKPEEQRPEASQPSQPSQL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctgccacttctttctacgacttccagccgctagacaaaaagggcgaacccttc
cccctgactggcctcaaaggcaaagtcgtcctcatcgttaacaccgcctccaaatgcggc
ttcactccacaattcaagggtctcgaatccctctacacctccctctcgactacctaccct
ggtaaattcaccatcatcggctttccctgcaaccaattcggctcgcaggagccaggaacc
aatgacgaaatccaatccttttgctccgccaactacggcgtcacgttccctgtcctgagc
aaagtcgacgtgaacggcgaaaacgcggcccctctgtggaaatggctcaagtctgagatg
cccggtatcatgggcatgaagcgtgtgaagtggaactttgagaagtttttggtcagtgcg
gatggaaaggttgtccatcgttgggcgagctttacgaagcctgagtcgctgagacatgcg
attgagaaggagatccataaggccgagggacaacctgcggaacaggaaccagctaccgag
gttccgacggtgaaacctgaagagcaacgtcctgaggcttcacaaccttctcagccttcg
cagctgtga

DBGET integrated database retrieval system