KEGG   Paracoccidioides brasiliensis: PAAG_04549Help
Entry
PAAG_04549        CDS       T02230                                 

Definition
mitochondrial 2-methylisocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAAG_04549
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PAAG_04549
Enzymes [BR:pbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PAAG_04549
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 605 aa AA seqDB search
MIRNPARRLPRQLLPLFRPSILPNHAVRTFACSCSRMGSPLPPVTPPVSTAHASDSFQLL
SSAEKTGPAEDALFNEQVKAVTEWWNTPRYEGIRRPYSAEAVVSKRGSLQQTYPSSIMAR
KLFNLLNERAKTGKPVHTLGAIDPVQMTQQAPNQEVLYISGWACSSLLTTTNEVSPDFGD
YPYNTVPNQVQRLFKAQQMHDRKQWDSRRKLSPEERKNTPYTDFMRPIVADGDTGHGGLT
AVLKLAKLFAENGAAAVHFEDQLHGGKKCGHLAGKVLVPIGEHINRLVAARFQWDLMGTE
TLLIARTDSESGKLLSSSIDVRDHEFILGVTENSDPLAETLQKLESEGASGPEIDKFESQ
WVKNHKLVTFDEAVEQHLKSEGATQSSINAYKKQVSENRDLSLNERRSLAAKYTKSPVFW
SWDIPRTREGFYHYRAGNAAATKRAINFAPYADLLWVETGDPSVETAATFAGHIRAKYPG
KKLVYNLSPSFNWMGHGFSEASLKSFIWDIAKHGFVLQLISLAGLHSNATMTTELSRGFK
DDGMLSYVNLIQRREKEIGVDVLTHQKWSGASYMDGIVGSILSGSSSNKSMGEGNTESST
SGVIH
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcaaccctgctcgccggttgcctcgacagcttctcccgctcttccgcccttcc
attctccccaaccacgctgtcagaactttcgcctgcagctgttcacgaatggggtcacca
ctccctccagtcaccccaccagtgtctacagctcatgcctccgattcattccagctcctc
tcgtctgctgagaagaccgggcctgctgaagatgcactcttcaatgaacaggtaaaagca
gtgacagaatggtggaacaccccccgctacgaaggtatcaggcgaccatattctgcagaa
gctgttgttagcaagcggggatcattgcagcagacgtatccaagctctattatggccagg
aaactatttaacttgttgaatgagcgggcaaagaccgggaaaccagtacatacccttggt
gcaattgatcccgtccaaatgacacaacaggctcccaatcaagaagttctttatatttct
ggatgggcctgttcatcgctcctgacgacgactaacgaagtatcccctgactttggtgac
tatccctacaacacggtaccaaaccaggtccagagactttttaaagcccagcaaatgcac
gaccgcaaacaatgggattcgagaaggaaactgtctccagaggaacgcaaaaatacaccc
tacactgatttcatgcgaccaatagtggcagatggtgatacgggccacggaggcctgaca
gcagtcctgaaactagcaaaactctttgctgaaaatggagctgctgccgtccacttcgag
gaccagctgcatggggggaagaaatgtggtcatcttgccggcaaagtactcgttccaatt
ggggaacacatcaacaggcttgtggcagctagattccagtgggatcttatgggaactgaa
acacttctcattgcgagaacggactccgaaagtggaaagcttctaagcagctctatcgat
gtccgggaccacgagttcatcctgggtgttactgaaaactccgatccgcttgcagagaca
ctgcagaaattggagtctgagggagcttcggggcctgagatcgacaaatttgaatctcag
tgggtaaagaatcacaagcttgttactttcgatgaagcggttgagcaacatcttaaatcc
gaaggagccacccagtcatccatcaacgcttacaagaagcaagtcagcgaaaatcgggac
ttgtcactaaatgaacgacgatcgcttgcagccaaatacaccaaatcccccgtgttctgg
tcctgggacatcccccgcacccgtgagggtttctaccattaccgggccggcaatgccgcg
gcaaccaagcgcgcgatcaattttgcaccctacgccgatttactctgggttgaaaccggc
gacccaagtgtggagacggccgcaacgtttgcaggacatatccgagcgaaatacccgggt
aagaagctggtttataacctcagtccctcattcaactggatgggtcacggcttctccgaa
gccagcctcaaatcgtttatctgggatatcgctaagcacgggttcgttctccaacttatc
tcgcttgccggcctccactccaacgccactatgacaaccgagctctcccgtggattcaaa
gacgatggcatgctttcttacgtcaaccttatccagagacgggagaaggaaatcggcgtt
gatgtccttacgcatcaaaagtggagtggagcctcgtatatggacggcattgtcggctcg
attctcagcggcagttcttctaacaagagtatgggtgaaggaaatactgaatcttcaact
tctggagtcatccactaa

DBGET integrated database retrieval system