KEGG   Paracoccidioides brasiliensis: PAAG_04766Help
Entry
PAAG_04766        CDS       T02230                                 

Definition
7-dehydrocholesterol reductase
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    PAAG_04766
Enzymes [BR:pbl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     PAAG_04766
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 426 aa AA seqDB search
MEEVISTAVPCQADQKSYKLQLIPKDVIPSWGRRTEVPRLHGALSLVIMMACPTTILFWY
VALQHFDGSLLSAAVALKNEGLFSFYHQYCPVPNLQTALAYGGWVLFQALLYSFLPGSTQ
EGQPTPAGNVLKYKINGMLAAMVTVWLFAIISLYGGFPVSTFVADNWGSLLTTFNIYGLF
LTLAFYLKAHLWPSHPEDRKFSGSPLYDLYMGIELNPRLGQSWDMKLFHNGRPGIIGWIL
MYLKTIDMAHDHVGFYLAWGSAAWLPTIYTLQPQFLAVHPVTLSPTAAATILTAGLGGYA
LFRSANHQKFLVRDTQGKCLIWGKSPEFIHGEYKTTNGLTHKSIIICSGWWGVVRHANYL
GDLILSYAMCATCGFTHLLPWTYALFMTTILVHRCYRDEQRCIKKYGKTWEEYCNKVKWR
IIPGIF
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagtcatttcaactgcagttccttgtcaagcggatcagaagagttacaaactc
cagttgattccaaaggacgtcatcccatcatggggcaggcgaactgaagtccctcgactt
catggcgcgttgtctctcgtgatcatgatggcatgtcctaccacaatactcttctggtat
gtggccctacagcattttgacggatccttactgtcggctgctgtggccctcaaaaacgag
ggtctcttttcgttttatcaccagtactgcccagtccccaatttgcaaactgccttggca
tatggaggatgggttctattccaggccctgctttacagctttctcccagggtcaactcag
gaaggtcagccaacccctgcggggaacgttctgaaatacaaaatcaatgggatgttggct
gcgatggttactgtgtggctatttgccattatcagcttgtatggagggtttccggtttca
actttcgttgccgacaattggggttcactgcttaccactttcaatatctatggcttgttt
ctcaccctggccttctacctaaaagcccacctttggccatctcatcctgaggacagaaag
ttcagcggatctccattgtacgatctttacatgggaattgagttgaacccacgcttgggc
caatcctgggatatgaaactgtttcacaatggccgtcctggcatcattggctggatattg
atgtacctcaaaactattgacatggctcacgaccacgttggattttatctagcctggggt
tccgcagcctggctcccgacaatatacacgttgcagccccagtttttagctgttcacccg
gttactctgtctccaactgcagctgctacgattttgactgctggtcttggtggatatgca
cttttccggtctgcgaatcaccaaaagttcctcgtgcgtgatacccagggcaaatgtttg
atttggggcaaatctccagagtttatccatggcgagtacaaaaccacaaacggtctgact
cataaatcgatcataatctgttccggatggtggggggttgtccgtcatgcgaattacttg
ggagatctcatcctgtcctatgcgatgtgcgctacctgcggatttacccatttgctcccg
tggacatatgctctattcatgacaacaattcttgtccaccggtgctatcgagatgaacag
cgatgtatcaagaaatacgggaagacttgggaggagtactgcaacaaagtcaagtggagg
atcatccctgggatcttttaa

DBGET integrated database retrieval system