KEGG   Paracoccidioides lutzii Pb01: PAAG_04902Help
Entry
PAAG_04902        CDS       T02230                                 

Definition
(RefSeq) hypothetical protein
  KO
K06634  
cyclin H
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PAAG_04902
  Replication and repair
   03420 Nucleotide excision repair
    PAAG_04902
Transcription machinery [BR:pbl03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PAAG_04902
DNA repair and recombination proteins [BR:pbl03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     PAAG_04902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 497 aa AA seqDB search
MYEDEIYRTSSQYRLWSFTEESLRTIRANTNAVASERVRAALRRSTTDAKHTTPAPPRSG
SGTPNPAGDADDSSNKTPETAGKNGEQTEREIECLTPEEELELVRYYCEKTMELGEEYKP
PLPTVVRATAIQYLRRFYLSNSPMTYHPKSIMPCALFLATKTENYYMPLRSFAEHIPNST
PEDIIAPEYLLTQGLRFTFDVRHPFRSLEGGIMELGAIANGNGVPGPYHPEQVSTGLQQS
ILSLPPPPPSPANPNPKEVLISSRLAKAHHNAREILRSAAQMTDVYFLYTPSQIWLSALL
LVDKPLAQFYIDTKLVPTDPQVAANAAAEPRLDSPATKMFASLRAKLSLVLDSCSTSLST
YQTNHTLATAPATMKNLKRIGKKLYHCQNPEKMDLKSLSRAARREASSADLSMQGVSGPV
DTDTVAAAGGVTAGADAVVDASTSASAEAGAGVGSEENAELQRAAKKRKLEREKFEKEGG
MLFGGDLMEERKRIKDV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaagacgagatctaccgcacgtcttcacaataccgcctctggtcatttaccgaa
gaatccctccgcacaatacgcgccaacaccaacgcagtcgccagtgagcgtgtcagggcc
gcattacggcggtcaacaacggacgcgaaacataccaccccagctcctccgcggtcgggg
agcggtacgccaaacccagcgggcgatgcagatgatagtagcaataaaacaccagagacg
gcggggaagaatggggagcaaactgagagggagattgagtgcttgacgcctgaagaggag
ctggagttggtgagatattattgcgagaagaccatggaattgggggaggagtataagccg
cccctgccaactgttgttagggctaccgcaatccaatatctccgccgtttctatctcagc
aattccccaatgacctaccaccccaaatccatcatgccctgcgctctcttcctagccaca
aagacagaaaattactacatgcccctacgctcttttgcagagcacatcccaaactcgaca
ccagaagatatcatcgcacccgaatatctcctcactcagggactgcgcttcacatttgat
gtccgccacccattccgcagtctggaaggcgggataatggaactaggagccattgccaat
ggcaacggggttccagggccataccatccagagcaagtgagcaccggtctgcaacaatcg
atactctcacttccaccccctcctccatctcccgcaaacccaaatccaaaggaggttctc
ataagctcccgtctagctaaggcgcaccacaatgcacgcgaaatcctacgctccgccgcg
caaatgacggatgtatatttcctctatacaccgtctcaaatctggctttctgccctcctc
ctggtcgataaaccactagcccaattctatatagacacaaaactcgtcccaaccgatccg
caagtagcagcaaacgcagcagcagaaccacgcctagactccccagccacaaaaatgttc
gcatccctccgggctaaactctctctcgtcctcgactcctgctccacctccctctccacc
taccaaactaaccacacccttgcaaccgcgccagccacgatgaagaacctcaaacgtatt
gggaagaagttataccattgtcagaatccggagaagatggatttgaaaagcctaagtcgc
gctgcgaggcgggaggcttcctctgcggatttgtcaatgcaaggcgtttcggggcctgtg
gatacggacactgttgcggctgcgggtggtgtcactgctggtgctgatgctgttgttgat
gctagtactagtgctagtgctgaagcgggtgctggtgttgggagtgaggagaatgcggag
ctgcagcgggccgcgaagaagcgaaaactggaaagggagaaatttgagaaggaagggggg
atgctttttggaggggatttgatggaggagaggaagaggattaaggatgtgtag

DBGET integrated database retrieval system