KEGG   Paracoccidioides brasiliensis: PAAG_04909Help
Entry
PAAG_04909        CDS       T02230                                 

Definition
catechol O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    PAAG_04909
Enzymes [BR:pbl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     PAAG_04909
Exosome [BR:pbl04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PAAG_04909
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 292 aa AA seqDB search
MMGVDRPYLPKPETHCGDGREVELLQYIYSLPNLEELRGSPSKIVEAIDQYGRDNYYLMN
VGSVKGPIITSLIAAVKPQVMVELGGYVGYSAILFGDAVRKAGGKRYYSLEKDPVFGAVS
TLLLNLAGLGDFVQVIIGPSDISLYNLHRSGTINRIDLLFLDHYKPAYVVDLKLCEQLGM
IVPGSILAADNVISPGNPPYLKYVRSNVEEKRHEAASNPAACRGYDLRGFSKSIINRYGI
SGEKAMTAVSISGNPNLIYESRLVNSFEPTGEPDGVEITRCIGTARTSISKL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgatgggtgttgacagaccatatttgccaaaaccggagactcattgtggcgatggacgg
gaggtcgaattgcttcaatatatatacagtttaccaaatcttgaagaactccgtggatct
ccgtcaaagatcgtggaggccattgatcaatatggaagggataattattaccttatgaat
gtcggctcagttaaaggtcccatcattacctccttgatagctgcagtcaaaccgcaggtt
atggttgagctaggtggctatgtgggatattctgccattttgttcggggatgcagtccga
aaggcgggggggaagagatactacagtttggagaaggaccctgtattcggagcagtctcc
acattgctgctgaacctggctgggcttggtgattttgtccaggtcattatcgggcccagc
gatatatccctttacaatctgcacagaagtggcaccataaatcggattgatctgctgttt
ctggaccattataagccggcgtacgtggtcgatttgaaactctgtgagcaacttggaatg
attgttccgggtagtatcctagcagcagacaacgtcatatctccaggaaacccaccatac
ttgaagtatgtaaggagcaatgtcgaggagaagagacatgaagctgcatctaatccagct
gcatgccgaggttatgatcttcgagggttttccaaatcaatcatcaatcgctatggaatt
tctggggagaaagcgatgacggcggttagtatatccggcaacccaaatctgatttatgaa
agcagactggtaaatagctttgagcctacaggagaacctgatggagtggaaataactcgt
tgcattggaactgcaaggacatccatcagcaaactgtag

DBGET integrated database retrieval system