KEGG   Paracoccidioides lutzii Pb01: PAAG_05033Help
Entry
PAAG_05033        CDS       T02230                                 

Definition
(RefSeq) mitogen-activated protein kinase
Organism
pbl  Paracoccidioides lutzii Pb01
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 349 aa AA seqDB search
MALGGSRKISFNVSDQYDIQDVIGEGAYGVVCSALHKPSGQKVAIKKITPFDHSMFCLRT
LREMKLLRYFNHENIISILDIQKPRNYESFTEVYLIQELMETDMHRVIRTQDLSDDHCQY
FIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASTDDNSGFMTEYV
ATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLNGKPLFPGKDYHHQLTLILDVLGTPT
MEDYYGIKSRRAREYIRSLPFKKKIPLKALFPKTSDLALDLLEKLLAFNPVKRISVEDAL
RHPYLEPYHDPEDEPTADPIPEEFFDFDKNKDSLSKEQLKVLIFEEIMR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggccctgggagggtcgaggaagatatccttcaatgtttctgatcagtatgacatccag
gatgtgattggcgaaggcgcatatggtgttgtctgctccgccctccacaaaccatctggc
cagaaggtcgctataaagaagataaccccgttcgatcactcgatgttctgtctgcgcacg
ctgcgcgagatgaaactcttgagatacttcaatcatgaaaacatcatttctatcctcgac
atccagaagccccgtaactacgagagctttactgaagtatacctcatccaggaacttatg
gagacagatatgcaccgtgtgatccgaacccaggacctttccgacgaccattgccagtac
tttatctaccagaccctgcgagccctgaaagctatgcactctgcgaacgttcttcaccgt
gatctgaaaccatccaacttgctccttaacgcgaattgtgatctgaaagtctgtgatttc
ggcctagcccgttccgctgcttcaacagacgacaactctggatttatgacagaatatgta
gccacccgttggtatcgtgccccggaaatcatgttgaccttcaaagaatacaccaaagcg
attgatgtgtggagcgttggttgcatattagcggaaatgttgaacggcaaacccctgttt
cctggcaaggactatcaccaccaacttacccttatcctcgacgttcttggaacaccaacc
atggaagactattacggcatcaagtcgcgtcgcgctcgagaatatatcagatcccttccg
ttcaaaaagaagatacccttgaaagctcttttccccaagacctccgatctggctttggac
ctgcttgagaagctccttgcattcaatcctgtcaaacgcatcagtgtcgaagacgctttg
cgccacccatacctggaaccctaccacgatccagaggatgaaccaactgctgaccccatc
cccgaagaattctttgatttcgacaaaaataaggactccttgagcaaggagcagctaaaa
gttcttatctttgaggagatcatgcggtag

DBGET integrated database retrieval system