KEGG   Paracoccidioides brasiliensis: PAAG_05033Help
Entry
PAAG_05033        CDS       T02230                                 

Definition
mitogen-activated protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pbl  Paracoccidioides brasiliensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 360 aa AA seqDB search
MALGGSRKISFNVSDQYDIQDVIGEGAYGVVCCFEYAALIGSSSALHKPSGQKVAIKKIT
PFDHSMFCLRTLREMKLLRYFNHENIISILDIQKPRNYESFTEVYLIQELMETDMHRVIR
TQDLSDDHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAAST
DDNSGFMTEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLNGKPLFPGKDYHHQL
TLILDVLGTPTMEDYYGIKSRRAREYIRSLPFKKKIPLKALFPKTSDLALDLLEKLLAFN
PVKRISVEDALRHPYLEPYHDPEDEPTADPIPEEFFDFDKNKDSLSKEQLKVLIFEEIMR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggccctgggagggtcgaggaagatatccttcaatgtttctgatcagtatgacatccag
gatgtgattggcgaaggcgcatatggtgttgtctgctgttttgagtatgcagctctgata
ggttctagctccgccctccacaaaccatctggccagaaggtcgctataaagaagataacc
ccgttcgatcactcgatgttctgtctgcgcacgctgcgcgagatgaaactcttgagatac
ttcaatcatgaaaacatcatttctatcctcgacatccagaagccccgtaactacgagagc
tttactgaagtatacctcatccaggaacttatggagacagatatgcaccgtgtgatccga
acccaggacctttccgacgaccattgccagtactttatctaccagaccctgcgagccctg
aaagctatgcactctgcgaacgttcttcaccgtgatctgaaaccatccaacttgctcctt
aacgcgaattgtgatctgaaagtctgtgatttcggcctagcccgttccgctgcttcaaca
gacgacaactctggatttatgacagaatatgtagccacccgttggtatcgtgccccggaa
atcatgttgaccttcaaagaatacaccaaagcgattgatgtgtggagcgttggttgcata
ttagcggaaatgttgaacggcaaacccctgtttcctggcaaggactatcaccaccaactt
acccttatcctcgacgttcttggaacaccaaccatggaagactattacggcatcaagtcg
cgtcgcgctcgagaatatatcagatcccttccgttcaaaaagaagatacccttgaaagct
cttttccccaagacctccgatctggctttggacctgcttgagaagctccttgcattcaat
cctgtcaaacgcatcagtgtcgaagacgctttgcgccacccatacctggaaccctaccac
gatccagaggatgaaccaactgctgaccccatccccgaagaattctttgatttcgacaaa
aataaggactccttgagcaaggagcagctaaaagttcttatctttgaggagatcatgcgg
tag

DBGET integrated database retrieval system