KEGG   Paracoccidioides lutzii Pb01: PAAG_05033Help
Entry
PAAG_05033        CDS       T02230                                 

Definition
(RefSeq) mitogen-activated protein kinase
  KO
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
MAPK signaling pathway - yeast
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    PAAG_05033
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    PAAG_05033
Enzymes [BR:pbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PAAG_05033
Protein kinases [BR:pbl01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PAAG_05033
Chromosome [BR:pbl03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     PAAG_05033
Exosome [BR:pbl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PAAG_05033
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 349 aa AA seqDB search
MALGGSRKISFNVSDQYDIQDVIGEGAYGVVCSALHKPSGQKVAIKKITPFDHSMFCLRT
LREMKLLRYFNHENIISILDIQKPRNYESFTEVYLIQELMETDMHRVIRTQDLSDDHCQY
FIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASTDDNSGFMTEYV
ATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLNGKPLFPGKDYHHQLTLILDVLGTPT
MEDYYGIKSRRAREYIRSLPFKKKIPLKALFPKTSDLALDLLEKLLAFNPVKRISVEDAL
RHPYLEPYHDPEDEPTADPIPEEFFDFDKNKDSLSKEQLKVLIFEEIMR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggccctgggagggtcgaggaagatatccttcaatgtttctgatcagtatgacatccag
gatgtgattggcgaaggcgcatatggtgttgtctgctccgccctccacaaaccatctggc
cagaaggtcgctataaagaagataaccccgttcgatcactcgatgttctgtctgcgcacg
ctgcgcgagatgaaactcttgagatacttcaatcatgaaaacatcatttctatcctcgac
atccagaagccccgtaactacgagagctttactgaagtatacctcatccaggaacttatg
gagacagatatgcaccgtgtgatccgaacccaggacctttccgacgaccattgccagtac
tttatctaccagaccctgcgagccctgaaagctatgcactctgcgaacgttcttcaccgt
gatctgaaaccatccaacttgctccttaacgcgaattgtgatctgaaagtctgtgatttc
ggcctagcccgttccgctgcttcaacagacgacaactctggatttatgacagaatatgta
gccacccgttggtatcgtgccccggaaatcatgttgaccttcaaagaatacaccaaagcg
attgatgtgtggagcgttggttgcatattagcggaaatgttgaacggcaaacccctgttt
cctggcaaggactatcaccaccaacttacccttatcctcgacgttcttggaacaccaacc
atggaagactattacggcatcaagtcgcgtcgcgctcgagaatatatcagatcccttccg
ttcaaaaagaagatacccttgaaagctcttttccccaagacctccgatctggctttggac
ctgcttgagaagctccttgcattcaatcctgtcaaacgcatcagtgtcgaagacgctttg
cgccacccatacctggaaccctaccacgatccagaggatgaaccaactgctgaccccatc
cccgaagaattctttgatttcgacaaaaataaggactccttgagcaaggagcagctaaaa
gttcttatctttgaggagatcatgcggtag

DBGET integrated database retrieval system