KEGG   Paracoccidioides brasiliensis: PAAG_05092Help
Entry
PAAG_05092        CDS       T02230                                 

Definition
hypothetical protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.4.19.12]
Organism
pbl  Paracoccidioides brasiliensis
Brite
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PAAG_05092
Peptidases [BR:pbl01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PAAG_05092
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1128 aa AA seqDB search
MCLITVCPGKTTPRFIQDVLCYDPAHPPSSGFNLLTQVPPAFQDPNDYPELISPNACPHR
YITKHNQTKLPPEGFQAGLRAPYKISAVCLICRFHLEIKTSHMTESSHCPSQLHHLVYSH
SNHHDTSPFRSKGQHQETHFYRCSYYEDLGVTEDMSADLIIEAYNRQIETDPRRAPYYLR
CLRSIGGWRRNSDGAKIDHLVTLECSGYRYADDDIPRAYNYFQLDYRNRNLTDDDIIGSF
FALLRDTPNDTEPRQQLWRIGDSRGSEKIKSVAEERKFHALRQTDIPAKLFVGISTVEQA
LVYLGAEEKTSDDFIVSMYAAKVNDQPASKELARKAVSLIAEARKSDSLKYFLNTGETVT
AEMDVGEAFRLLQIPDRTVDDAAILAAFSVCCSEAPGQIDAYRKALDVIAKEKGSAMISS
TLAQDAAQANRDLKEWPVGLQNIGNTCYLNSLLQFYFTVTPFRKMVVHFDDYRMPLDEAS
LAKKKIGSRKVSIAEIKRSQKFLRELQSLFKKMISSPTSSVTPEQELARLTLISSSNEAA
IRRKSIITHGRTSLSEINGLPVIGPLGPPSATTDLPSDGTMADPSSKGQEPNDADSDVTL
VSLSGQPDNEESGADNKENVSRGSQDIIVEMKEVNDSKNTDVATGDPSRTFGPIAPPSRA
PPPVPPRPVPQVDPQQQLRDEVELWAQQDVTEVINNVLFQTQCAVKPIRFDKDGEQLDVV
TDLFYGKTVTYLTTENGVRSKEESWSDIKVDVATGSKHIYSAIDGAFDMQKVEVDGAEVE
QYGTISRVPPVLQIQVQRVQFDQVKKTSFKSTHHLELKEMIFLDRYMDSNKHHIDDRRRE
CWRWKEELLKLRARKDELLYNESWECLPDVFKDAKAHVQNLMAMKDDPETAGEAMEIDDG
VLSRLSAVEEMTRDEIKCNQFADLRHLAYSLYAVFVHHGSVEFGHYYIYIFDFDKNLWRK
YNDSEVTEVQSKAEIFERQNLHNPPTPYFLVYVNERMKERLVKPVNREIEEISPCVVSPL
PAPAPDSEPVKVVRGQQANGSGPSQTEISASKDVNMDEPPAYNEIEYEPAAGMNNAKGAD
AMAMANGKATTTSSTATTTAAVAVAASTAATLKGKWNKKFANLPSVSW
NT seq 3387 nt NT seq  +upstreamnt  +downstreamnt
atgtgtctcataactgtctgtccagggaaaaccaccccccgctttatccaagatgtcctc
tgttatgatcctgcgcaccctcctagctccggcttcaacctcttgacccaggtacctccc
gccttccaggaccccaatgactatccggaactcatctccccgaacgcctgcccccatagg
tatatcaccaaacataaccagaccaagcttccccctgaaggcttccaggctgggctaagg
gcaccttacaagatttccgctgtctgcttgatatgccgctttcatttggaaatcaagaca
tcacatatgacagaatcgtcccattgtcctagtcagctacaccatcttgtttactcgcat
agcaatcatcacgatacaagccctttccgcagcaaaggccagcatcaggaaactcacttc
taccgttgttcatattatgaggatctcggggtgacggaggatatgtctgctgatctcatc
attgaggcatataatcgacagatcgaaactgatccacgacgggctccttattatctccga
tgtctacgatctatagggggatggagacgtaattcagacggggcaaaaattgaccatctt
gtcacattggagtgtagtggctatcgatacgctgatgacgatataccacgcgcatataac
tattttcaactagattatcgcaatcgaaacctgactgatgatgacattatcggatctttc
tttgctcttcttcgtgataccccgaacgacacggaaccaagacagcaactctggagaata
ggtgacagtcgaggcagtgagaagatcaaatcagtggcagaagagcgtaagtttcatgcc
ctcagacagacagatattccggctaagctcttcgtaggtatatccaccgtggagcaagcg
ctagtatatcttggtgcagaggagaaaacctctgatgatttcattgtttccatgtacgct
gcaaaggtcaacgaccaaccagcgagtaaagagctcgcgcggaaggctgtttctttgatc
gccgaggcacgcaaatccgactccctcaaatacttcctcaatactggcgaaacagtgaca
gcggaaatggatgtaggcgaggcttttcgactcttgcaaatcccagatcggactgtcgat
gatgctgcgattcttgctgcattttctgtatgttgctcagaggctcccggtcaaatcgac
gcgtatagaaaagccctggatgtcattgccaaagagaaaggaagtgcaatgataagcagc
actctagcacaagacgcggcacaagcaaaccgcgatctcaaagaatggcctgtcgggctg
caaaatattggaaacacttgttatctcaacagcttgctccaattttacttcacagtgacc
ccttttcgcaaaatggtggttcactttgatgactacaggatgcctttagatgaggcgagt
ctcgcgaagaagaagatcggatctcgaaaagtctcaattgcagaaataaagcggtctcaa
aaatttctccgggagcttcaatcactgtttaaaaagatgatctcatcacctacttcatct
gtcacgcctgagcaggaacttgcacgtttaactctcattagctcttcaaacgaagcagct
atccggaggaaatccataataactcacggtcgtaccagcctaagtgagataaatggcttg
cccgttatcggaccactaggacctccgagcgctacgacagacttgcccagtgatgggaca
atggctgacccgagtagtaaagggcaagaacctaatgacgcagacagcgatgtaacgctt
gtttcattatctggacagccagacaatgaggaatcaggggctgacaacaaggaaaacgtg
tcgcgtggttctcaggatataattgttgaaatgaaagaagtaaatgattccaagaataca
gatgtagcgacgggtgatccttcccggactttcggacccatagcccctccgagcagggct
ccccctcctgtaccccctcgaccagtaccacaagttgatccacagcaacaactcagagat
gaagttgagctctgggcgcagcaggatgttacagaagttattaacaacgttctattccag
actcaatgtgctgtcaaaccgatcagattcgacaaagacggagagcagctcgacgtagtt
accgatttgttttatggcaagaccgttacctaccttactacagaaaatggggttcgatcc
aaagaagagtcttggtcagatatcaaggtcgatgttgctaccggttctaaacacatatat
tctgcaattgacggcgccttcgatatgcaaaaggtagaggttgacggcgctgaggtggag
caatacggcaccatcagcagggtgcctccagttctgcaaatacaagtccagcgcgtccag
tttgatcaagtcaagaagacttcgtttaagtcgactcatcacctggagttgaaagaaatg
atattcctagacaggtatatggatagtaataaacaccacatagatgacagacgccgtgaa
tgctggcggtggaaggaggaacttctaaagctaagagcgcgcaaagatgaacttttatat
aatgagagttgggaatgtttgcctgatgtgttcaaggacgcaaaagcccacgttcaaaat
ctgatggctatgaaagatgaccctgagaccgcaggagaggcaatggagatcgatgacggg
gttttatcacgtctctcggcagtggaagagatgacaagggatgaaatcaaatgcaatcaa
ttcgccgatcttcgtcatctcgcctacagcctgtatgctgtcttcgtacatcacggctcc
gttgaatttggccattactacatctacatatttgattttgacaagaacttgtggcgaaaa
tataatgacagcgaagtaaccgaagtccaaagtaaagcggaaattttcgagaggcagaac
ctacacaacccccccaccccttacttcctcgtctacgtcaacgaacgcatgaaggaacgt
ctggttaagcccgtcaatcgcgaaatcgaagagataagtccctgtgtggtgtcgccgcta
ccagcaccggcaccggactcagaaccagtgaaggtggtacgcggccagcaagccaatgga
tccggaccgtcgcaaacggaaatttcagctagcaaggatgtgaatatggatgaacccccg
gcgtacaatgaaatagaatatgaacctgctgcaggtatgaacaatgccaaaggcgcagac
gcgatggcgatggcaaatggcaaagccactaccacttcttccactgccaccaccaccgcc
gccgttgctgtcgccgctagcaccgctgccactctcaaaggaaaatggaataagaagttt
gctaacctcccctctgtgtcctggtag

DBGET integrated database retrieval system