KEGG   Paracoccidioides lutzii Pb01: PAAG_05092Help
Entry
PAAG_05092        CDS       T02230                                 

Definition
(RefSeq) hypothetical protein
  KO
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.4.19.12]
Organism
pbl  Paracoccidioides lutzii Pb01
Brite
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PAAG_05092
Peptidases [BR:pbl01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PAAG_05092
Ubiquitin system [BR:pbl04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    PAAG_05092
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1305 aa AA seqDB search
MCLITVCPGKTTPRFIQDVLCYDPAHPPSSGFNLLTQVPPAFQDPNDYPELISPNACPHR
YITKHNQTKLPPEGFQAGLRAPYKISAVCLICRFHLEIKTSHMTESSHCPSQLHHLVYSH
SNHHDTSPFRSKGQHQETHFYRCSYATCAVIITLNILSPVLAPRWVDLLINPELLKARTD
EALNAYPERLEGHIRPFPITVLSNLRAYIENALHEPQRSKPICLNNKRFVVCFGVDGRPC
RELLEFLEFTPGEDSWKPPSPDTSAPIPYEKALNVFLDNVSNELLVLIHQRPEHEKDGQS
REPKFDPALKKFSQLLGSSTYDRVYSNSSENQDTGRFPYYEDLGVTEDMSADLIIEAYNR
QIETDPRRAPYYLRCLRSIGGWRRNSDGAKIDHLVTLECSGYRYADDDIPRAYNYFQLDY
RNRNLTDDDIIGSFFALLRDTPNDTEPRQQLWRIGDSRGSEKIKSVAEERISTVEQALVY
LGAEEKTSDDFIVSMYAAKVNDQPASKELARKAVSLIAEARKSDSLKYFLNTGETVTAEM
DVGEAFRLLQIPDRTVDDAAILAAFSVCCSEAPGQIDAYRKALDVIAKEKGSAMISSTLA
QDAAQANRDLKEWPVGLQNIGNTCYLNSLLQFYFTVTPFRKMVVHFDDYRMPLDEASLAK
KKIGSRKVSIAEIKRSQKFLRELQSLFKKMISSPTSSVTPEQELARLTLISSSNEAAIRR
KSIITHGRTSLSEINGLPVIGPLGPPSATTDLPSDGTMADPSSKGQEPNDADSDVTLVSL
SGQPDNEESGADNKENVSRGSQDIIVEMKEVNDSKNTDVATGDPSRTFGPIAPPSRAPPP
VPPRPVPQVDPQQQLRDEVELWAQQDVTEVINNVLFQTQCAVKPIRFDKDGEQLDVVTDL
FYGKTVTYLTTENGVRSKEESWSDIKVDVATGSKHIYSAIDGAFDMQKVEVDGAEVEQYG
TISRVPPVLQIQVQRVQFDQVKKTSFKSTHHLELKEMIFLDRYMDSNKHHIDDRRRECWR
WKEELLKLRARKDELLYNESWECLPDVFKDAKAHVQNLMAMKDDPETAGEAMEIDDGVLS
RLSAVEEMTRDEIKCNQFADLRHLAYSLYAVFVHHGSVEFGHYYIYIFDFDKNLWRKYND
SEVTEVQSKAEIFERQNLHNPPTPYFLVYVNERMKERLVKPVNREIEEISPCVVSPLPAP
APDSEPVKVVRGQQANGSGPSQTEISASKDVNMDEPPAYNEIEYEPAAGMNNAKGADAMA
MANGKATTTSSTATTTAAVAVAASTAATLKGKWNKKFANLPSVSW
NT seq 3918 nt NT seq  +upstreamnt  +downstreamnt
atgtgtctcataactgtctgtccagggaaaaccaccccccgctttatccaagatgtcctc
tgttatgatcctgcgcaccctcctagctccggcttcaacctcttgacccaggtacctccc
gccttccaggaccccaatgactatccggaactcatctccccgaacgcctgcccccatagg
tatatcaccaaacataaccagaccaagcttccccctgaaggcttccaggctgggctaagg
gcaccttacaagatttccgctgtctgcttgatatgccgctttcatttggaaatcaagaca
tcacatatgacagaatcgtcccattgtcctagtcagctacaccatcttgtttactcgcat
agcaatcatcacgatacaagccctttccgcagcaaaggccagcatcaggaaactcacttc
taccgttgttcgtatgcgacatgcgccgtgatcatcaccctgaacatactctctccagtg
ctagcgccgcgatgggtagatcttttgataaatccggagctgttaaaggctaggaccgac
gaggccttgaatgcatatcctgagcgactagagggtcatattcgaccatttcccattacc
gtgctgtcaaaccttcgcgcatacatagaaaatgccttacatgagccccagagaagcaag
ccgatatgcctaaacaataaacgttttgttgtttgctttggcgtcgatggccgaccgtgc
cgggagctgttggaatttcttgaatttactccaggggaagattcctggaagcctccatcc
cctgatacaagcgcgccaataccgtacgagaaggctctgaatgtatttcttgacaacgtg
tcaaatgaactcctcgttctcatccaccaaagaccagagcatgagaaagacggtcaatca
cgagaacccaaattcgatcctgccttgaagaaattcagtcagctcctgggttcatcgacc
tacgacagggtatactctaactcatcggaaaatcaggacacgggaagatttccatattat
gaggatctcggggtgacggaggatatgtctgctgatctcatcattgaggcatataatcga
cagatcgaaactgatccacgacgggctccttattatctccgatgtctacgatctataggg
ggatggagacgtaattcagacggggcaaaaattgaccatcttgtcacattggagtgtagt
ggctatcgatacgctgatgacgatataccacgcgcatataactattttcaactagattat
cgcaatcgaaacctgactgatgatgacattatcggatctttctttgctcttcttcgtgat
accccgaacgacacggaaccaagacagcaactctggagaataggtgacagtcgaggcagt
gagaagatcaaatcagtggcagaagagcgtatatccaccgtggagcaagcgctagtatat
cttggtgcagaggagaaaacctctgatgatttcattgtttccatgtacgctgcaaaggtc
aacgaccaaccagcgagtaaagagctcgcgcggaaggctgtttctttgatcgccgaggca
cgcaaatccgactccctcaaatacttcctcaatactggcgaaacagtgacagcggaaatg
gatgtaggcgaggcttttcgactcttgcaaatcccagatcggactgtcgatgatgctgcg
attcttgctgcattttctgtatgttgctcagaggctcccggtcaaatcgacgcgtataga
aaagccctggatgtcattgccaaagagaaaggaagtgcaatgataagcagcactctagca
caagacgcggcacaagcaaaccgcgatctcaaagaatggcctgtcgggctgcaaaatatt
ggaaacacttgttatctcaacagcttgctccaattttacttcacagtgaccccttttcgc
aaaatggtggttcactttgatgactacaggatgcctttagatgaggcgagtctcgcgaag
aagaagatcggatctcgaaaagtctcaattgcagaaataaagcggtctcaaaaatttctc
cgggagcttcaatcactgtttaaaaagatgatctcatcacctacttcatctgtcacgcct
gagcaggaacttgcacgtttaactctcattagctcttcaaacgaagcagctatccggagg
aaatccataataactcacggtcgtaccagcctaagtgagataaatggcttgcccgttatc
ggaccactaggacctccgagcgctacgacagacttgcccagtgatgggacaatggctgac
ccgagtagtaaagggcaagaacctaatgacgcagacagcgatgtaacgcttgtttcatta
tctggacagccagacaatgaggaatcaggggctgacaacaaggaaaacgtgtcgcgtggt
tctcaggatataattgttgaaatgaaagaagtaaatgattccaagaatacagatgtagcg
acgggtgatccttcccggactttcggacccatagcccctccgagcagggctccccctcct
gtaccccctcgaccagtaccacaagttgatccacagcaacaactcagagatgaagttgag
ctctgggcgcagcaggatgttacagaagttattaacaacgttctattccagactcaatgt
gctgtcaaaccgatcagattcgacaaagacggagagcagctcgacgtagttaccgatttg
ttttatggcaagaccgttacctaccttactacagaaaatggggttcgatccaaagaagag
tcttggtcagatatcaaggtcgatgttgctaccggttctaaacacatatattctgcaatt
gacggcgccttcgatatgcaaaaggtagaggttgacggcgctgaggtggagcaatacggc
accatcagcagggtgcctccagttctgcaaatacaagtccagcgcgtccagtttgatcaa
gtcaagaagacttcgtttaagtcgactcatcacctggagttgaaagaaatgatattccta
gacaggtatatggatagtaataaacaccacatagatgacagacgccgtgaatgctggcgg
tggaaggaggaacttctaaagctaagagcgcgcaaagatgaacttttatataatgagagt
tgggaatgtttgcctgatgtgttcaaggacgcaaaagcccacgttcaaaatctgatggct
atgaaagatgaccctgagaccgcaggagaggcaatggagatcgatgacggggttttatca
cgtctctcggcagtggaagagatgacaagggatgaaatcaaatgcaatcaattcgccgat
cttcgtcatctcgcctacagcctgtatgctgtcttcgtacatcacggctccgttgaattt
ggccattactacatctacatatttgattttgacaagaacttgtggcgaaaatataatgac
agcgaagtaaccgaagtccaaagtaaagcggaaattttcgagaggcagaacctacacaac
ccccccaccccttacttcctcgtctacgtcaacgaacgcatgaaggaacgtctggttaag
cccgtcaatcgcgaaatcgaagagataagtccctgtgtggtgtcgccgctaccagcaccg
gcaccggactcagaaccagtgaaggtggtacgcggccagcaagccaatggatccggaccg
tcgcaaacggaaatttcagctagcaaggatgtgaatatggatgaacccccggcgtacaat
gaaatagaatatgaacctgctgcaggtatgaacaatgccaaaggcgcagacgcgatggcg
atggcaaatggcaaagccactaccacttcttccactgccaccaccaccgccgccgttgct
gtcgccgctagcaccgctgccactctcaaaggaaaatggaataagaagtttgctaacctc
ccctctgtgtcctggtag

DBGET integrated database retrieval system