KEGG   Paracoccidioides lutzii Pb01: PAAG_05160Help
Entry
PAAG_05160        CDS       T02230                                 

Definition
(RefSeq) hypothetical protein
  KO
K03505  
DNA polymerase delta subunit 4
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PAAG_05160
   00240 Pyrimidine metabolism
    PAAG_05160
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PAAG_05160
   03410 Base excision repair
    PAAG_05160
   03420 Nucleotide excision repair
    PAAG_05160
   03430 Mismatch repair
    PAAG_05160
   03440 Homologous recombination
    PAAG_05160
DNA replication proteins [BR:pbl03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    PAAG_05160
DNA repair and recombination proteins [BR:pbl03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      PAAG_05160
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     PAAG_05160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 209 aa AA seqDB search
MPTTTRRRSGNHHQSTLSFGGQHKVSKPTSTSSLAGKKGLKADVSSPVAEVRQRSASGSA
SPAPTASPATTVVTHPAEIEPEQKPVAASSKSENVIAEQARVELRQPKSEEDVRAEALTE
MDIRQYWQREEEGRIAARVHQQHLTVDEKILRHFDLSNQYGPCIGIARIKRWRRAHMLNL
NPPIEVLAVLLKDEAKGIANEKAYMDELL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccaccacacggcgccgctcaggcaaccatcaccagtccaccctctccttcggc
ggccaacataaagtctccaaaccaacctcaacctcttccctcgccggtaaaaagggactg
aaagccgatgtcagctctccagtcgctgaggtccgtcagcggagtgcctcaggttcagcc
tcgccagcacccacagcctcaccagcgacgactgtggttacacaccctgctgagatcgag
ccggagcaaaagcctgttgctgcgtcgtcgaagagcgagaatgtgatcgcggaacaggcg
agggttgagctgcggcaacccaagtctgaggaggatgtgagggctgaggcattgacggag
atggacattaggcaatactggcaaagggaggaggaagggagaattgctgccagggtgcac
cagcaacatttgacggtggatgagaagatactacgacatttcgacctgtcgaatcaatat
gggccatgtatcgggattgcacgaataaagcgctggagacgagcacacatgcttaacctt
aatcctcccattgaagtccttgctgtgctgttgaaagatgaagcaaagggcattgcaaac
gagaaggcatatatggatgagttgttgtaa

DBGET integrated database retrieval system