KEGG   Paracoccidioides lutzii Pb01: PAAG_05160Help
Entry
PAAG_05160        CDS       T02230                                 

Definition
(RefSeq) hypothetical protein
  KO
K03505  DNA polymerase delta subunit 4
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00230  Purine metabolism
pbl00240  Pyrimidine metabolism
pbl01100  Metabolic pathways
pbl03030  DNA replication
pbl03410  Base excision repair
pbl03420  Nucleotide excision repair
pbl03430  Mismatch repair
pbl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PAAG_05160
   00240 Pyrimidine metabolism
    PAAG_05160
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PAAG_05160
   03410 Base excision repair
    PAAG_05160
   03420 Nucleotide excision repair
    PAAG_05160
   03430 Mismatch repair
    PAAG_05160
   03440 Homologous recombination
    PAAG_05160
DNA replication proteins [BR:pbl03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    PAAG_05160
DNA repair and recombination proteins [BR:pbl03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      PAAG_05160
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     PAAG_05160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_delta_4
Motif
Other DBs
NCBI-GeneID: 9096227
NCBI-ProteinID: XP_002793024
UniProt: C1H317
Position
Unknown
AA seq 209 aa AA seqDB search
MPTTTRRRSGNHHQSTLSFGGQHKVSKPTSTSSLAGKKGLKADVSSPVAEVRQRSASGSA
SPAPTASPATTVVTHPAEIEPEQKPVAASSKSENVIAEQARVELRQPKSEEDVRAEALTE
MDIRQYWQREEEGRIAARVHQQHLTVDEKILRHFDLSNQYGPCIGIARIKRWRRAHMLNL
NPPIEVLAVLLKDEAKGIANEKAYMDELL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccaccacacggcgccgctcaggcaaccatcaccagtccaccctctccttcggc
ggccaacataaagtctccaaaccaacctcaacctcttccctcgccggtaaaaagggactg
aaagccgatgtcagctctccagtcgctgaggtccgtcagcggagtgcctcaggttcagcc
tcgccagcacccacagcctcaccagcgacgactgtggttacacaccctgctgagatcgag
ccggagcaaaagcctgttgctgcgtcgtcgaagagcgagaatgtgatcgcggaacaggcg
agggttgagctgcggcaacccaagtctgaggaggatgtgagggctgaggcattgacggag
atggacattaggcaatactggcaaagggaggaggaagggagaattgctgccagggtgcac
cagcaacatttgacggtggatgagaagatactacgacatttcgacctgtcgaatcaatat
gggccatgtatcgggattgcacgaataaagcgctggagacgagcacacatgcttaacctt
aatcctcccattgaagtccttgctgtgctgttgaaagatgaagcaaagggcattgcaaac
gagaaggcatatatggatgagttgttgtaa

DBGET integrated database retrieval system