KEGG   Paracoccidioides brasiliensis: PAAG_05160Help
Entry
PAAG_05160        CDS       T02230                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pbl00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pbl00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:pbl03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:pbl03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:pbl03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:pbl03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pbl03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 209 aa AA seqDB search
MPTTTRRRSGNHHQSTLSFGGQHKVSKPTSTSSLAGKKGLKADVSSPVAEVRQRSASGSA
SPAPTASPATTVVTHPAEIEPEQKPVAASSKSENVIAEQARVELRQPKSEEDVRAEALTE
MDIRQYWQREEEGRIAARVHQQHLTVDEKILRHFDLSNQYGPCIGIARIKRWRRAHMLNL
NPPIEVLAVLLKDEAKGIANEKAYMDELL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccaccacacggcgccgctcaggcaaccatcaccagtccaccctctccttcggc
ggccaacataaagtctccaaaccaacctcaacctcttccctcgccggtaaaaagggactg
aaagccgatgtcagctctccagtcgctgaggtccgtcagcggagtgcctcaggttcagcc
tcgccagcacccacagcctcaccagcgacgactgtggttacacaccctgctgagatcgag
ccggagcaaaagcctgttgctgcgtcgtcgaagagcgagaatgtgatcgcggaacaggcg
agggttgagctgcggcaacccaagtctgaggaggatgtgagggctgaggcattgacggag
atggacattaggcaatactggcaaagggaggaggaagggagaattgctgccagggtgcac
cagcaacatttgacggtggatgagaagatactacgacatttcgacctgtcgaatcaatat
gggccatgtatcgggattgcacgaataaagcgctggagacgagcacacatgcttaacctt
aatcctcccattgaagtccttgctgtgctgttgaaagatgaagcaaagggcattgcaaac
gagaaggcatatatggatgagttgttgtaa

DBGET integrated database retrieval system