KEGG   Paracoccidioides brasiliensis: PAAG_05241Help
Entry
PAAG_05241        CDS       T02230                                 

Definition
bifunctional pyrimidine biosynthesis protein (PyrABCN)
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pbl00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pbl00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2214 aa AA seqDB search
MPLLNPSLDAKGPSPAHANSVRRRSTAPSKPAIGGAVAYFQNLREVLPSLSPQANSDKGG
AIPPAAAPMSAEGLKWYALELEDGTVYQGYSFGAERSIAGELVFQTGMVGYPESITDPSY
RGQILVVTFPLVGNYGVPSRQTVDELLGDLPKCFESTEIHVAGLVVASYCGEDYSHFLAG
SSLGTWLKEQGVPAMYGVDTRSLTKRIREEGSMLGRILLQKPNVSTEILNGDAASSLAIV
DEDRLDDWRALFEQIEWVDPNKRNLVNDVSIRKPRLFSPPKDLALSHPSGRTIRVLCVDV
GMKYNQLRCLLARGVEVLVVPWDYDFPSLAGKEYDGLFLSNGPGDPAMVSKTVGYIHSAL
EDCRTPIFGICLGHQLLARAAGASTTKMKFGNRGHNIPCTSLMSGRCYITSQNHGYAVDA
MTLPEGWEELFVNANDGSNEGIRHLSRPIFSVQFHPESAPGPRDTEFLFDVFIDTIKKSV
VSSSVLHEPVSFPGPTAEETDLAHPRVSVKKVLILGSGGLSIGQAGEFDYSGSQAIKALR
EEGIYTILINPNIATIQTSKGLVDKVYFLPVNAEFVRKVIKHERPDAIYVTFGGQTALQV
GIQLKDEFEQLGVKVLGTPIDTIITTEDRELFARSMESIGEKCAKSASASTLEEAMEAVK
DIGFPVIVRAAYALGGLGSGFAEDPDQLRDLCMKAFAASPQVLIERSMKGWKEIEYEVVR
DARDNCITVCNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECN
IQYALNPFSREYCIIEVNARLSRSSALASKATGYPLAFIAAKLGLGIPLNEISNSVTKVT
CACFEPSLDYVVVKIPRWDLKKFTRVSTQLGSSMKSVGEVMSIGRTFEEAIQKAIRAVDF
HNVGFNATNALMSIKAELQTPSDQRLFAIANAMHSGYTVDDIWELTKIDKWFLRKLKGLS
NFGTSLTSYNATTIPVSLVRQAKQLGFSDRQLAKFLSSNELAIRRLRVEAGIMPVVKQID
TVAAEFPAFTNYLYLTYNGSKNDVDFNDNGVMVLGSGVYRIGSSVEFDWCSVRTIRTLRE
QGHKTVMVNYNPETVSTDYDEADRLYFENINLETVLDIYQLESSSGVIISMGGQTPNIIA
LPLHRLNVNILGTSPEMIDTAENRYKFSRLLDHIGVDQPAWKELTSIEEATEFCAKVGYP
VLVRPSYVLSGAAMNTVYSLDDLASYLNQAAEVSREHPVVITKYIENAKEIEMDAVAKNG
VMVGHFISEHVENAGVHSGDATLILPPQDLDPQTVSRIEEATRKIGNALNVTGPFNIQFI
AKDNDIKVIECNVRASRSFPFVSKVMGVDLIEMATMAMIGKPFVEYPLVTVPKNYVGVKV
PQFSFSRLSGADPVLGVEMASTGEVACFGRDRYEAYLKALISTGFKLPKKNILFSIGSFK
EKLEMLPSIRKLHALGYNLFATAGTADYLKEHGLPVKYLEVLAGEEEDLKSEYSLTQHLA
NNLIDLYINLPSSNRFRRPANYISKGYRTRRMAVDYQTPLVTNVKNAKILIEAIARHYPM
NVMSIDCQTSYRSVTLPGLINIAAFVPGLANPDSPDFQEVTKASISNGFSMVRIMPVGVD
SFVTDSQALRTAQHNAGKGSYCDFNLSVAATSANSDKVGQITSEVGSLFIPFNHLSGNIN
KVATVTAHFASWPTTKPIITDAKATDLASILLLASLHNRNIHVMSVTSKDDIGLIALSKE
KGLMVTCDVSIYSLFLSQDDYPGCTCLPSKKDQQTLWEYMDTIDVFSIGSLPYQVAGSHA
SAAVGIQDALPLLFTAISDNRLTVDDVTSRLYDNPKRIFELHDQPDTSVEVEFDRPYVVQ
GRGVWSPFTGKTLKGSVGRVIFQGKTSCLDGEMMPDAPKGSDMSSHHLAPPAPLSPVARE
IVPSTPQRESSLARRLSISTTPLARPSRLRDPSEGYPVPNSVDELVPVAPLYPYPIKIST
SVQQLLSHSAFKQKHIISVSQFNRTDLHLLFTVAQEMRLGVQRHGVLDILKGRVLTTLFF
EPSTRTSASFDAAMQRLGVNDITITFIGDLKYGRTVHSLVKLLQFYDVRVQLVSPKALAI
PEEVRQQLVAAGQLILESTELTPESLARSDVLYCTRVQKERFEDLNEYERLKNTFVIDNT
VLKHAKSQMIVMHPLPRNQEICEEVDFDQRAAYFRQMKYGLYCRMALLALVMVS
NT seq 6645 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcctcaatccctctctggatgccaaaggcccgtctcctgctcatgccaactcc
gtgaggagaagatcaactgccccttctaaacccgctatcggtggtgcagtcgcatacttc
cagaacttaagagaagtcttgccgtccctctctccccaggctaattctgacaagggcggt
gctattccccccgcagcagcccccatgtctgcggagggcctcaagtggtacgctttggag
ctcgaagacggcactgtctaccaaggttacagcttcggtgcggaaagaagcatcgcggga
gaattggtgttccagaccggcatggtgggatacccagaatccatcacagacccttcttac
cgtggccagattttggttgtcactttccccttggtgggaaactatggcgttccctcgcgc
cagaccgtagatgagctgctgggtgatctgcctaagtgcttcgagtcaactgaaatccac
gttgctggtctcgtcgtcgctagttactgtggagaggattactcccacttcttagctggg
tcgtctctgggcacatggttgaaggagcagggagtgccggccatgtacggtgtcgacacc
cgttccctcaccaaaagaattcgagaagaaggaagcatgcttggccggattctgctacag
aaacccaacgtcagcaccgaaattctcaatggagatgccgcgagcagcctagcaattgtt
gacgaagatagacttgatgactggagggcactctttgaacagattgaatgggtggatcct
aacaagagaaaccttgttaacgatgtttctatcaggaaaccccgattgttctccccacca
aaggatttggcgctttcccacccatctggtcgcaccatcagagttctgtgtgtggatgtt
ggtatgaaatacaatcaactgcggtgcctgctcgctcgcggcgttgaggtccttgtcgtt
ccctgggattatgattttcctagcttagccggaaaggaatacgatgggctattcctgtct
aatggtccaggagatcctgccatggtttctaaaaccgttgggtatattcattcggcactc
gaggactgccgaactcctattttcggtatctgtcttggtcaccagttgctagcccgggcc
gctggcgcaagcactacaaaaatgaagttcggtaacagaggccataacatcccatgtacc
agccttatgtctggccgctgctatatcacatcacaaaaccacggttatgcagtggacgcc
atgacgttaccggaaggatgggaggaacttttcgttaatgccaatgatggaagcaatgaa
ggtatcagacatctttcacgcccaattttcagtgtgcaattccacccggagagcgctcct
ggacctcgggacaccgagtttttgtttgatgtatttatcgacaccatcaagaagagcgta
gtgtcgtccagtgtccttcatgagcccgtcagctttcctggcccgactgcagaagaaact
gatcttgctcatccgagagtcagcgttaaaaaggttctcattcttggttcgggcggtctc
agtataggtcaagctggagagtttgactattctggaagccaagctataaaggccctgaga
gaggaaggaatctacaccatcctcatcaaccctaatatcgctacgatccagacatcaaag
ggtctcgtagacaaagtctactttctgcctgtcaatgcagagtttgtgcgcaaggttatt
aagcatgaacgcccagatgccatctatgtaacgtttggtggccaaaccgccctccaggtt
ggcatccagctcaaagatgagttcgaacagcttggtgttaaggtcctcggtaccccgatc
gacaccatcattactaccgaagatcgtgagctattcgcgagaagcatggaatctattggc
gaaaaatgtgccaaatccgcatccgcatccactctcgaggaagctatggaagctgtcaag
gatatcggattccctgtcattgttcgcgctgcatacgcacttggtggacttggaagtggc
tttgctgaggacccagaccaattgcgggacctgtgcatgaaagcctttgccgcaagcccc
caagttctcattgagaggagtatgaaagggtggaaggaaattgagtatgaagtcgtccgt
gacgcccgtgataactgcatcactgtttgtaacatggaaaattttgatccacttggtatc
catacaggtgattcaattgttgtagctccttcgcaaaccctgtctgatgaggactacaat
atgctccgaacaacagccgtcaatgtcattcgtcatttgggggttgttggcgaatgtaac
atccagtacgcgctgaacccgttttccagagaatattgcattattgaggtcaatgctcgc
ttgtcaaggtcatccgcactcgcctccaaagccacgggttatcctctcgcttttattgcc
gcaaaactcggtctcggtattccgctgaatgagatctctaactccgtaacaaaggtcacc
tgtgcttgtttcgagccgtcgctagattatgttgttgtcaaaattccccgttgggacctc
aagaaattcactcgtgtctctacccagctaggatcttccatgaagagtgttggtgaagtc
atgagtattggaagaacttttgaagaggccattcaaaaggccatccgtgctgtagacttt
cacaatgttggctttaatgcaacaaacgcactcatgtccatcaaagccgaactccaaacg
ccttccgatcagcgattgtttgctatcgccaacgcaatgcattccggttacactgttgat
gatatttgggagttaaccaaaattgacaagtggtttttgcgcaagctgaagggcctcagt
aattttggaacgtctttgactagttataatgccaccaccattcccgtatcgctcgtcaga
caagcaaaacaactcggtttctcagacaggcagctggccaagtttttgagctccaatgaa
ttggctatcagacggctgcgagtggaagcgggcatcatgcccgtagttaagcaaatcgat
acagttgccgctgaattccctgcgtttactaactacttgtatttaacttacaacggctct
aagaatgatgttgatttcaatgacaatggtgttatggtgcttggatccggtgtctacaga
attggctcctctgtcgagttcgattggtgctctgtcaggaccatccgaactctacgagag
caagggcacaagacagttatggttaactataacccggaaactgtcagtactgactatgat
gaagctgatcgactttattttgagaatatcaacttggaaactgtattggatatatatcag
cttgaatcgtccagtggagttatcatttctatgggtggacaaacaccaaacatcatcgcc
ttgcctctgcatcggttgaacgtcaatattctgggcacgtctcccgaaatgattgacact
gctgagaatcgctacaagttctctcgactccttgaccacatcggtgtcgaccagcctgct
tggaaggaactaaccagcattgaggaggctaccgaattttgcgctaaggttggataccct
gttttggtgcggccgtcttatgtgctttctggcgctgctatgaacacggtttattcgttg
gacgatcttgcaagctatcttaaccaggctgctgaagtctcacgtgaacatccagtagta
atcactaagtatatcgaaaacgccaaggaaattgaaatggatgccgtggcgaagaatggc
gttatggtcggtcatttcatctcagaacatgttgaaaatgctggcgttcattcaggtgat
gctactttgatcctcccaccgcaagatttggacccgcaaaccgtcagccggatcgaagag
gccacccgcaagattgggaatgccctgaacgttaccgggccattcaatattcaatttatc
gccaaggataatgacatcaaagttatcgagtgtaatgtcagggcatcgcgatctttccca
ttcgtttccaaggttatgggtgttgacctgatcgaaatggcaacgatggcgatgattgga
aagccatttgtggaatacccgctcgtcactgttccgaagaactacgtcggagtcaaagtc
ccccaattttcattctctcgcctttccggtgctgaccccgttcttggcgtggagatggcg
tcaactggtgaagttgcatgctttggccgtgacagatacgaggcatatcttaaagctctt
atctcaaccggcttcaagcttcctaagaaaaatatcctcttctccatcggttcttttaaa
gagaaacttgagatgcttccgtcgatcaggaagctccacgcgctaggatataacctattc
gcaacagcaggcactgcagactatctcaaggaacacggtcttccagtgaagtatctcgaa
gttcttgcgggagaagaggaggacctcaagtcagaatactctcttacgcagcatcttgcc
aacaatctgattgatctgtacatcaatcttccctccagcaataggtttagacgaccagca
aactacataagcaaaggttatcgaactcgtcgaatggcggtcgactaccagactccacta
gttaccaatgtgaagaatgcgaagattttgatcgaggcgattgctcgtcattacccgatg
aacgtgatgagcattgattgccaaacaagctatcgctctgttactctcccaggccttatc
aatatcgcagcatttgtgccaggtctcgcaaaccccgattctccggactttcaggaggtg
accaaggcttccatttctaatggctttagcatggttcgcatcatgcccgtcggtgtggat
agctttgtcaccgattcccaagcactgagaactgcccagcataacgccggcaagggctcg
tactgcgatttcaacttgtctgttgcggcaacctctgccaattctgacaaggttggacaa
atcacgagtgaagtcggttcactgttcatcccctttaaccacctatcgggaaatatcaac
aaggttgcgacggttacggcgcactttgcttcctggcccaccactaagccaatcatcact
gatgccaaagcgaccgacttggcttccattctgctccttgccagcctccacaatcgtaat
atacacgtgatgagtgttacaagcaaagatgatattggcctgattgccctcagcaaggag
aaaggcctcatggtgacctgcgacgtgtccatctactccctcttcctctcccaggatgat
tatcctggttgcacatgtcttccatctaagaaagaccaacagacgctgtgggagtacatg
gatacaattgacgtcttttccattggaagtcttccttaccaggttgcgggtagccatgcc
tctgcagctgtcggcatccaagacgcacttcccctgctctttactgctatttccgacaac
cgcctaaccgtggacgatgttacctccagactctatgataacccgaaaaggatctttgaa
cttcatgaccagcccgatacttccgtggaggtcgaatttgaccgaccatatgtagtccag
ggccgtggcgtttggtcaccctttactggcaagacgttaaagggatctgtcggtcgagtt
atatttcaaggaaagacctcttgcttagatggcgaaatgatgccagatgcgccaaaggga
tcagacatgtccagtcatcatcttgcacccccagcgccattatcacccgtagccagggaa
atcgttccttcgacccctcaacgcgaaagctctctcgcaagacggttgtctatctcaacc
acaccgcttgcgcgtccatcgaggcttagggatccttctgaagggtaccctgtacctaat
tctgtggatgaattagttcccgttgcgcccctttatccatatccaatcaagatatctact
tcggtgcaacagctgctctcgcactccgccttcaaacagaaacatatcatttcagtcagc
cagttcaatcgtacagatcttcatcttctcttcaccgttgcacaagagatgcggttgggt
gttcaacgtcatggcgtcctcgacattttgaaaggcagagttctcacaacgctattcttt
gagccttctacccgcacctccgcttcctttgatgccgctatgcagcgattgggcgtcaac
gacatcacgatcacttttatcggcgatctgaaatacggccgtactgtacattcactcgtc
aaacttctccaattctatgacgttcgcgtccagcttgtctcgcccaaggcgctggctatc
cctgaagaggttcgccaacagcttgtggcggccggccagcttattcttgaatcgactgaa
ctgaccccggagagcctggcacggtctgatgtactttactgcacgcgcgtgcagaaggaa
cggttcgaagacctgaacgagtacgagagactgaagaatacctttgtcatcgacaataca
gtgctcaaacatgcaaagagccagatgattgtcatgcaccctctaccgcgcaaccaggag
atctgcgaagaggttgactttgaccagcgtgcggcctatttccgacagatgaaatacgga
ctctactgtcgcatggcattgctcgcattggtcatggtatcgtga

DBGET integrated database retrieval system