KEGG   Paracoccidioides lutzii Pb01: PAAG_05254Help
Entry
PAAG_05254        CDS       T02230                                 

Definition
(RefSeq) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00052  Galactose metabolism
pbl00561  Glycerolipid metabolism
pbl00600  Sphingolipid metabolism
pbl00603  Glycosphingolipid biosynthesis - globo and isoglobo series
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PAAG_05254
  Lipid metabolism
   00561 Glycerolipid metabolism
    PAAG_05254
   00600 Sphingolipid metabolism
    PAAG_05254
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    PAAG_05254
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     PAAG_05254
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Melibiase Raffinose_syn
Motif
Other DBs
NCBI-GeneID: 9096261
NCBI-ProteinID: XP_002793118
UniProt: C1H3B1
Position
Unknown
AA seq 489 aa AA seqDB search
MVVWIPSALCLAVGLFARCAPALDNGLALTPQMGWNTWNSFYCDLNEEVVLDAADKIVQL
GFMDLGYEYIVLDDCWSAGRNSSDYLQPNLEKFPSGIDGLAAKIHAMGLKIGIYSSAGTK
TCARYEGSLGYEEKDAELWASWGIDYLKYDNCYNEGQEGTPLLSFNRYNVMGKALNATGR
PILYSLCNWGIDGPWNFAPTIANSWRITGDLFLNYNRETPECPCAELGGLDCKLPGFRCS
VMNVLNKAAYLPSKGFSGAWNDLDMLVVGNGGLTDDAMVAHFSLWAALKSPLLMSLVLSK
IDAKSLSILQNIAVLAISQDSAGLSATRKWRKYVGDVDELGKQGEIQMFSGSLAGGDEVV
LFLNAAASDRQMESSLEDIFWDRGPSGIAPEIQETWDIYDLWANRMDDETALTIINGNAS
PEVIAERNLTALGGPKKVFAKVPQSTSAAFMGLKIGSVRPGGVVTAFVRAYGVAMFRLRR
KPSLHRDEL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggttgtttggatcccctcagctttgtgtcttgctgtgggattattcgcccgctgcgct
ccggctttggataatgggctggcgttgacgccacagatgggttggaatacgtggaactcg
ttttattgcgacctcaatgaggaagtggttcttgacgcagcggataagatcgttcagctg
ggtttcatggaccttggctatgaatatattgtgttggatgattgttggtctgcgggacgc
aattcatccgactacttacaaccgaatctcgagaaatttccgagtggaattgatgggctt
gccgccaaaatacatgccatgggcctgaaaatcggaatatactctagcgctggaaccaag
acatgcgctcgctacgaaggttcgctgggctatgaagagaaagatgctgagctttgggca
agctggggaatcgattatctaaaatatgacaactgctacaatgagggtcaggaagggacg
cccctcctttcattcaatcggtacaacgtcatgggcaaggcccttaacgctacaggcaga
ccgattttgtatagtttgtgcaactggggtatcgacgggccatggaactttgcgcccact
attgctaattcgtggcgcataacgggagacctattcctcaactataacagggaaacaccg
gaatgcccctgcgcagaattgggcggtcttgattgcaagctccctggattccgctgctcg
gtgatgaatgttcttaacaaagcagcctaccttccatctaagggattttctggggcgtgg
aatgatttggacatgctcgtggtgggtaatggggggttgacggatgacgcaatggtcgca
cacttcagcttgtgggcggcattaaaatcaccactgctgatgtcacttgtcttgagtaag
attgatgcaaaaagcctctccattttgcaaaatatcgcagtcctggcgatctcacaagac
tctgctggtttatccgcaacccgtaaatggagaaagtatgtcggggacgtggatgaatta
ggaaaacaaggggaaattcagatgtttagtggtagtcttgctggaggggatgaagttgtc
ctgttcctcaacgcagcagccagcgataggcagatggagtcttcactggaagacatattc
tgggatcgggggcccagcggaattgctcccgaaatccaggagacatgggacatatacgat
ctgtgggcaaaccgcatggatgacgaaactgccttgacaattatcaatgggaatgcatct
ccggaagtcattgcggaacgcaacctaactgcgctgggaggccctaagaaggtatttgca
aaagtgcctcagtcaacctcggcggcattcatggggttgaagattggaagcgtgcggccc
ggtggtgttgtaacggcatttgtcagggcatatggcgtagcgatgttccgtcttcgccgg
aagccatccctccaccgggatgaattatga

DBGET integrated database retrieval system