KEGG   Paracoccidioides brasiliensis: PAAG_05293Help
Entry
PAAG_05293        CDS       T02230                                 

Definition
protein kinase wis1
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:pbl04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 659 aa AA seqDB search
MDSHDSPDSTDDDLSGPVPNLLSTSSLPSLESQLPALHSVGDNPSPAMPRSSTPLGHVNA
ARKPPVRPPGAIPRSSGLNQDIQAKMKAFSLSRQGAPPGANPYLNSNMPGGSPIVGSAIQ
GITLVGGPIPGGMARLPSHSSPVWPAHSPGSNPNSPVIQQKMGGLAAKRGLNRGMKLSDA
TGPHPGAANLGQFGSFPGASAVSQDARGPPETLFSKYSDFVDTKAGTLNFRNKAIIHSGG
IDFTSGSSFSISLDEVDTLEELGKGNYGTVYKVRHCRPHMRRPGVGLRGTLTRQQSSSQT
TTPLFNDAKCNTSNVIMAMKEIRLELDEAKFTAIIMELDILHRCVSPFIIDFYGAFFQEG
AVYICVEYMDGGSVEKVYGDGIPENILRKITLSTIMGLKSLKDEHNIIHRDVKPTNILIN
TRGQIKICDFGVSGNLVASIAKTNIGCQSYMAPERISGGGATPGGGTYSVQSDIWSLGLT
VVECAMGRYPYPPETFNNIFSQLNAIVHGDPPKLPEEGYSAEAKDFVQGCLNKIAALRPS
YDHLLRHPWLSSLRQPPNYHHPPRRHRTTDGDSADGVGMDMDIDMDMDIGITANVDPSKC
TSTPFETADGEVAAWVIDALDRRARGVMGKLERPALHAVALDAVPGSPLLEHSSAPSRN
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggatagccatgactcaccggattctaccgacgatgatctctcgggacccgtccccaat
ctcctgtcaacttcttcccttccttcgctcgagtctcagctcccagccctgcattccgtc
ggcgacaacccctccccagcgatgccccggtcgtccactccgcttggccacgttaatgca
gcccgaaaacctcccgttcgtcctcccggcgccatcccacgctcgagcggtttgaaccag
gacatccaggcgaaaatgaaggccttttcgctctctagacaaggggctccacccggggcg
aacccgtacttgaacagcaatatgcctggaggaagtcccatcgttggttctgcaatccag
ggtattactctggttggtggtccgataccgggaggcatggcgagactgccatcccattcc
tcccctgtgtggccggcgcattctcccggatcaaaccccaatagcccggtaatacaacaa
aaaatgggcggtttagctgcaaagagggggcttaatcgtggcatgaagctgtctgacgct
accggacctcatcctggggcagccaacctggggcaatttggaagttttccgggtgcatca
gctgtttcacaagacgctagaggccctcctgagaccctgttctccaaatactcagacttc
gttgacacgaaggcagggactttaaatttccgcaacaaggctattatccacagtggcggc
atagactttacctcggggagcagcttcagcatctcgttagatgaagttgacacccttgag
gaattgggcaagggcaactacggtaccgtctacaaggttcgacactgtcgtccgcatatg
cgaagacctggcgtgggattacgtggcacacttacaagacagcagtcgtcgtctcaaaca
acgacaccgctctttaatgacgcaaaatgcaacacatccaacgtcatcatggccatgaag
gaaatccgcctcgaactagacgaagcaaaattcaccgccattattatggagttggacatc
ctgcaccgttgtgtatcaccgttcatcatcgatttctacggtgcatttttccaggagggc
gctgtgtacatttgtgtggaatacatggacggtgggtccgttgaaaaagtttatggcgac
ggaatccccgagaatatcctccgaaaaatcactctgtccacgatcatgggtttgaaatct
ttgaaggatgaacacaacatcatccaccgcgacgttaaaccgactaatatcctaatcaac
acgcgtgggcagatcaagatttgtgattttggcgtcagtgggaatctggtggctagtatc
gcgaaaaccaacatcggctgccagagttacatggctccggagcggatttctggtggtggc
gccactcccggtggcggaacatatagtgttcagagcgacatatggagcttgggtctgaca
gtggtcgaatgcgccatgggccggtatccctaccctcccgagacgttcaacaatattttc
agccaattgaacgccatcgtccacggcgacccacccaaactgcccgaagaaggctactcg
gccgaagccaaggatttcgtccaaggctgtctgaacaaaatcgccgcgctgagacccagt
tacgaccacctcctccgccacccctggctatcatccctgagacaaccacctaattaccac
cacccaccccgccgccaccggacgaccgacggagacagcgccgatggtgtcggcatggac
atggacattgacatggacatggacatcggcatcaccgccaacgtcgacccttccaaatgc
acctcgacacccttcgaaacggccgatggggaagttgctgcgtgggtcattgatgcgctg
gataggcgtgcgcggggggtcatgggcaagctggagcggccggcgctgcatgctgtggcg
ctcgatgcggttccggggagtccgttgctggagcattcgtcggcgccgtcgcgtaattaa

DBGET integrated database retrieval system