KEGG   Paracoccidioides brasiliensis: PAAG_05296Help
Entry
PAAG_05296        CDS       T02230                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pbl00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 767 aa AA seqDB search
MEDVVVNTSVGSKEPVEPQNGVSRNMGPRTDTTSPQCQPTTGDLPGRPGVESRPIKQHRA
STGRRVTARPAPHSSPPSMASLGSLSTQIQSFKFESVIQDESDPEMQGRNVEESSHAQLT
LLAQVRDWLQQEKAKSSVRRMKKTGATESPVPAMASGDATHAATRQRSDSQCSDGTLALE
KLEQILAQYPVSGKEGIPSTVIRRKRSSISLRRRTSTRSLRRGSISDSNYSDADQAVPNA
NVALDNSKTLLYGGGEADSDFGNQGLNKPASKDKEHWIRFKYEIVRLTHTLGLRGWRRVP
IEDSRNIEVVRLSGALTNAVYVVSPPQNSPSTSSLAPKRPPPQLLLRIYGPQVEHLIDRK
NELQILRRLAKRNIGPRVLGSFNNGRFEQYFHARTLTPKDIRNPETSKQIAKRMRELHDG
IELLPEEIEGGPSIWKNWDKWVERCKQVASWLDREIMSSHNQSKSETECWRRQGFVCGLP
WPKFRMAVDAYRKWLVNFYGGAAAINQQLIFAHNDTQYGNLLRLEPSGESPLLLPPNEHK
QLVVIDFEYASANTRGLEFCNHFDSPIQPSSRQVNDRADQALDLEIRSLLRETLLWRAAN
SAQWVAWGIVQAKITGMEEALAAAASASAASTTTEKQAPETMAEMEETSTAESNDGSDHL
SEIADEHTGEFDYLAYAQDRALFFWADMLSLGLIKESELPTDMAERIKGHVIGFNRITAI
TLARVNPPPAFASKIALGRSNTPSFPLFICSLVRVFGIALAKLTIGD
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgtggtcgttaatacctccgtcggttccaaagaacccgtggaaccgcaaaat
ggcgtttctagaaatatgggcccaaggacagataccactagcccacaatgtcaaccaacg
actggagacttgcctggtcgacctggcgtggaaagtcggccaatcaagcaacatcgtgct
agcacaggaaggagagtaacagcacggccagcgccccactcttctcccccttctatggct
tcactgggctcgctaagcactcaaatccagagcttcaaatttgaatcagtcattcaagat
gagagtgaccccgaaatgcagggtcgcaatgttgaggaaagctcccatgctcagctaact
ttgctcgcacaagtccgtgactggttgcaacaagagaaagccaagtcttcagtgcggagg
atgaagaagactggtgccacagaatcccccgtgccggctatggcctctggagacgctacc
catgcggcaactcggcagagaagtgattcccaatgctcggatggaacattggctttggaa
aaactagagcagattttagcacaatatccggttagtgggaaggaaggtattccaagtact
gtaatccgccggaagagatcgtcaatctctctcaggcgtcgaactagtacaagaagccta
aggcggggttctatatccgattctaattactcggatgctgatcaagctgtgcccaatgct
aatgttgcccttgacaactccaaaactcttttatacggcggaggtgaagcggacagtgat
ttcgggaaccagggcttaaataaacccgcttctaaggacaaagaacattggataagattc
aaatatgaaatcgtacgcctgacgcatacgctgggcttaaggggctggagacgagtccct
atcgaagactctcgtaatattgaggttgttcgccttagtggagcactaacaaatgccgta
tatgttgtctctccaccgcaaaactcacctagtacttcttcacttgcgcctaagcgtcct
cctccgcaactcttattgcgcatctacgggccgcaagtggaacatttgattgatcgaaag
aatgaactccaaattctgcggcgtctggcaaaacggaatatcggaccccgtgtactgggg
tcgtttaacaatggccgtttcgaacagtattttcatgccagaactctcacgccaaaggac
attcgaaacccggagacctctaaacaaattgccaaacgaatgcgggagctgcatgatggc
attgaactgttgcccgaagagatagaggggggtccgtctatatggaagaactgggataaa
tgggttgagagatgcaaacaggtggcatcgtggttggatcgcgaaattatgtcttcgcat
aatcagtccaagtctgaaacagagtgctggcggcgacaaggctttgtgtgcggtttgcca
tggccaaagttccggatggcagttgacgcttatcggaagtggctggtaaatttctacggc
ggagcagctgcaattaatcaacagcttatatttgctcacaatgacacgcaatatggcaac
cttctccgccttgagccaagcggagaatctcctcttctgctacctccgaacgagcataag
cagcttgtagtcatcgactttgagtatgcgtcagccaacactcgcggtctggagttctgc
aaccactttgattcgcctatccaaccatcttcgcgacaggttaacgatcgagccgatcaa
gctcttgatctagaaatacgtagtctcctccgcgaaaccttactctggcgtgcggcgaat
tctgcgcagtgggtggcgtgggggatcgtccaggccaaaatcactgggatggaagaagct
ctcgcagcagcagcttccgcctctgctgcttcaacaacgacagagaaacaggcgcccgaa
acaatggccgaaatggaggaaacaagcaccgcggaatcaaacgacggaagcgaccacctc
agtgagatagccgacgaacacacgggagaatttgattacctagcttacgcacaggatcgg
gctctcttcttctgggcggatatgttgtcgctaggtcttataaaagagagcgagttgcct
actgacatggccgagcgtatcaagggacatgtaattggtttcaacagaattacggctatc
accctagcccgggtgaatccaccgcctgcatttgcttcgaaaattgcactagggcgctca
aatacgccatcgtttccgttgttcatttgtagtttggtacgagtatttggtattgcgctt
gctaaattgaccattggagactga

DBGET integrated database retrieval system