KEGG   Paracoccidioides lutzii Pb01: PAAG_05296Help
Entry
PAAG_05296        CDS       T02230                                 

Definition
(RefSeq) hypothetical protein
  KO
K00866  
choline kinase [EC:2.7.1.32]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PAAG_05296
Enzymes [BR:pbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     PAAG_05296
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 778 aa AA seqDB search
MGPRTDTTSPQCQPTTGDLPGRPGVESRPIKQHRASTGRRVTARPAPHSSPPSMASLGSL
STQIQSFKFESVIQDESDPEMQGRNVEESSHAQLTLLAQVRDWLQQEKAKSSVRRMKKTG
ATESPVPAMASGDATHAATRQRSDSQCSDGTLALEKLEQILAQYPVSGKEGIPSTVIRRK
RSSISLRRRTSTRSLRRGSISDSNYSDADQAVPNANVALDNSKTLLYGGGEADSDFGNQG
LNKPASKDKEHWIRFKYEIVRLTHTLGLRGWRRVPIEDSRNIEVVRLSGALTNAVYVVSP
PQNSPSTSSLAPKRPPPQLLLRIYGPQVEHLIDRKNELQILRRLAKRNIGPRVLGSFNNG
RFEQYFHARTLTPKDIRNPETSKQIAKRMRELHDGIELLPEEIEGGPSIWKNWDKWVERC
KQVASWLDREIMSSHNQSKSETECWRRQGFVCGLPWPKFRMAVDAYRKWLVNFYGGAAAI
NQQLIFAHNDTQYGNLLRLEPSGESPLLLPPNEHKQLVVIDFEYASANTRGLEFCNHFTE
WCYNYHDPDRPWACNTKWYPTPEEQERFVRAYLNHRPHIIQSTERRDTQSAPTSVPDTST
SSSAVGTPVYATHSNSPRLSPFMLDSQDSPIQPSSRQVNDRADQALDLEIRSLLRETLLW
RAANSAQWVAWGIVQAKITGMEEALAAAASASAASTTTEKQAPETMAEMEETSTAESNDG
SDHLSEIADEHTGEFDYLAYAQDRALFFWADMLSLGLIKESELPTDMAERIKGHVIGY
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgggcccaaggacagataccactagcccacaatgtcaaccaacgactggagacttgcct
ggtcgacctggcgtggaaagtcggccaatcaagcaacatcgtgctagcacaggaaggaga
gtaacagcacggccagcgccccactcttctcccccttctatggcttcactgggctcgcta
agcactcaaatccagagcttcaaatttgaatcagtcattcaagatgagagtgaccccgaa
atgcagggtcgcaatgttgaggaaagctcccatgctcagctaactttgctcgcacaagtc
cgtgactggttgcaacaagagaaagccaagtcttcagtgcggaggatgaagaagactggt
gccacagaatcccccgtgccggctatggcctctggagacgctacccatgcggcaactcgg
cagagaagtgattcccaatgctcggatggaacattggctttggaaaaactagagcagatt
ttagcacaatatccggttagtgggaaggaaggtattccaagtactgtaatccgccggaag
agatcgtcaatctctctcaggcgtcgaactagtacaagaagcctaaggcggggttctata
tccgattctaattactcggatgctgatcaagctgtgcccaatgctaatgttgcccttgac
aactccaaaactcttttatacggcggaggtgaagcggacagtgatttcgggaaccagggc
ttaaataaacccgcttctaaggacaaagaacattggataagattcaaatatgaaatcgta
cgcctgacgcatacgctgggcttaaggggctggagacgagtccctatcgaagactctcgt
aatattgaggttgttcgccttagtggagcactaacaaatgccgtatatgttgtctctcca
ccgcaaaactcacctagtacttcttcacttgcgcctaagcgtcctcctccgcaactctta
ttgcgcatctacgggccgcaagtggaacatttgattgatcgaaagaatgaactccaaatt
ctgcggcgtctggcaaaacggaatatcggaccccgtgtactggggtcgtttaacaatggc
cgtttcgaacagtattttcatgccagaactctcacgccaaaggacattcgaaacccggag
acctctaaacaaattgccaaacgaatgcgggagctgcatgatggcattgaactgttgccc
gaagagatagaggggggtccgtctatatggaagaactgggataaatgggttgagagatgc
aaacaggtggcatcgtggttggatcgcgaaattatgtcttcgcataatcagtccaagtct
gaaacagagtgctggcggcgacaaggctttgtgtgcggtttgccatggccaaagttccgg
atggcagttgacgcttatcggaagtggctggtaaatttctacggcggagcagctgcaatt
aatcaacagcttatatttgctcacaatgacacgcaatatggcaaccttctccgccttgag
ccaagcggagaatctcctcttctgctacctccgaacgagcataagcagcttgtagtcatc
gactttgagtatgcgtcagccaacactcgcggtctggagttctgcaaccactttacggaa
tggtgctataactaccacgatccagaccggccatgggcatgcaatacaaagtggtacccc
acccctgaagagcaggaacgattcgttagagcatatctcaatcatcgaccacacatcata
caatcgacggaaagacgtgatacccagtccgcacccacttcagttccggatacaagtacc
tcatcgagcgctgtggggactccagtctatgctacacattccaacagcccccgcttgtct
ccctttatgcttgacagtcaggattcgcctatccaaccatcttcgcgacaggttaacgat
cgagccgatcaagctcttgatctagaaatacgtagtctcctccgcgaaaccttactctgg
cgtgcggcgaattctgcgcagtgggtggcgtgggggatcgtccaggccaaaatcactggg
atggaagaagctctcgcagcagcagcttccgcctctgctgcttcaacaacgacagagaaa
caggcgcccgaaacaatggccgaaatggaggaaacaagcaccgcggaatcaaacgacgga
agcgaccacctcagtgagatagccgacgaacacacgggagaatttgattacctagcttac
gcacaggatcgggctctcttcttctgggcggatatgttgtcgctaggtcttataaaagag
agcgagttgcctactgacatggccgagcgtatcaagggacatgtaattgggtattga

DBGET integrated database retrieval system