KEGG   Paracoccidioides brasiliensis: PAAG_05548Help
Entry
PAAG_05548        CDS       T02230                                 

Definition
sphingosine N-acyltransferase lac1
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PAAG_05548
Enzymes [BR:pbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     PAAG_05548
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 471 aa AA seqDB search
MPRPRKSSSLGADIRGDTGAPAMSTMDSRASISDSPESPSSSVRNQRNGPERSGKSHSKR
RRARSLFRRWKDLALKHTWLTPLTLLLIILSIYAVNPTESNPVHSAIFLSYPTGRETPSG
PTMYAKGRKDLYFVGFYTIVLSFTREFIMQRIIRPWGVSCGIKSKAKMARFMEQGYTAIY
FGFSAPFGLYVMKQTDIWYFNTTAMFKGFPHRTLTADFKAYYLLEASYWAQQAIVLLLML
EKPRKDFKELVMHHIITLSLIGLSYRFHFTHIGLAVYITHDVSDFFLATSKTLNYLDSPI
IGPYFLTFICIWIYMRHYLNLRILWAVLTKFQTVGPFILNWATEQYKCRLSQVITFSLLS
ALQAINLLWLFLILRIAKNYVLSDVKRDERSDNEDDEDEHEEEKQTTPTKFPQIGDSSAN
AAVTGFGVLNNGISEPRVTRRAAKEKEIAARAGANGAGGDDGSPKLKKKSR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgaccacggaagtcgagtagtctcggtgcagacattagaggggacaccggagct
ccagctatgtccaccatggattcccgggcttccatatcggattcccctgagtctccctcg
tcttcggtgcgcaaccagcggaatgggccagaaaggagcggaaaatcacattcaaaacgg
cggagggcgcgctcactattccggcgatggaaagaccttgctctcaaacacacatggttg
acaccactcaccctactcctcattatcctctctatatacgccgtgaacccaacggaatcc
aaccctgtacactccgccattttcctctcgtaccctaccggtcgcgaaactcctagcgga
cccactatgtacgcaaagggcagaaaagacctctactttgtcggcttctacacgatcgtc
ctatccttcacacgcgaattcatcatgcagcgcatcatcagaccatggggcgtgtcctgt
ggcatcaagagtaaggccaagatggcccggttcatggagcaggggtacacggcgatatat
ttcgggttttccgcgccatttgggctctacgtcatgaaacagacggatatctggtatttc
aacacgacggctatgtttaaggggttcccgcataggacgctaacggcggatttcaaggca
tattacttgctggaagccagttactgggcgcagcaggcgattgtgctgctgttgatgctg
gaaaagcctaggaaggatttcaaggagctggttatgcatcatattattacattgtcgctc
attggcctaagttaccgtttccatttcacccacattggacttgcggtgtatatcactcat
gacgtttcggatttcttcctcgcgacctccaaaacacttaactacctggattccccaatc
attggtccttacttcctcacattcatttgcatctggatttacatgcggcattacctcaac
cttcgcatcctctgggccgtcctcaccaaattccaaaccgtcggccccttcattctcaac
tgggcaaccgaacagtacaagtgtcgtctcagccaggtcattacgtttagcttactaagt
gccctacaggccatcaatttgctctggctgttcctgatcctccgcatcgcaaagaactac
gtgctgagcgatgtgaagcgggacgagcggagtgacaatgaagatgatgaggacgagcat
gaagaggagaagcaaactaccccgacaaagttccctcagattggtgacagctctgcaaat
gctgccgtcacaggttttggtgtgctgaataatggtatttctgaaccgcgcgttacaagg
agggcggcgaaggagaaggaaatcgctgctagagctggagctaatggggctggtggtgat
gatggatcgcctaaattgaagaaaaagagtaggtaa

DBGET integrated database retrieval system