KEGG   Paracoccidioides brasiliensis: PAAG_05575Help
Entry
PAAG_05575        CDS       T02230                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:pbl04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 493 aa AA seqDB search
MNLSPFVTPRAIASHCCISSSSSTMPKKSSAILLIAAFWQTLLVNVDGLYTKNSPVLQVD
SSKYDHLIARSNQLSIVEFYAPWCGHCQNLKPVYEKVAKHLDGLAQVAAVNCDDDLNKPI
CGQMGIRGFPTLKVITPSKKPGNPRVEDYNGARTAKAIVEYMVDKIPNHVKKITDKEFDG
WLKEANDTAKAILFTEKPATSALLRALAIDYLGSINFAQIRNKETSAVQTFGIKKFPTIV
LLPGGGKEAISYGGELKKNPISDFLGQVAKASTDPKPSKSTASTTSEATESPETSSRSVS
PLPSKAPALNILSTTSDLRKVCLAPKTGTCVLVLGKMPESLDSEPPAGAFQAFTGLAEIS
HKHSLRKGHLFPFYAVPDTVEDVGVLRNKLELKKDSVIDVIALNAKRGWWQQYDPGEEGD
FSAAKLETWIDAIRLGEGAKKKLPDGVVFEEQEKVTEPTKEPEKEAGMEPKVESPKEPKQ
KPVKEEPTSHNEL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaacttatctcctttcgtaaccccccgtgcgatcgctagccactgttgcatttcatcc
agctcttccaccatgcccaagaagagctccgccattctgctaattgcagctttttggcag
acactactcgtaaatgtcgacggtctttataccaaaaactctccagtcctccaagttgac
agtagcaaatatgaccatttgattgcgcggtcaaatcagttatctattgtagaattctac
gctccatggtgtggacactgtcagaacttgaaacctgtatacgaaaaggttgccaagcac
cttgatgggctggcacaagttgccgctgttaattgcgatgacgacttgaacaaacccatc
tgtggccagatgggaatccggggattccctactcttaaagtcataaccccgtcgaaaaag
cccggaaacccacgagttgaagattataacggtgcgagaacggctaaagctatagttgaa
tatatggtggataagataccaaatcatgtaaaaaagattacagacaaggagttcgatggt
tggctaaaggaagcaaatgacactgcaaaagctattctgttcacagagaaacccgcgacc
agtgcacttctccgggcgttagctatcgactatctagggtcaattaatttcgcacagatt
cgaaacaaagagacttcagcggtacaaacctttggtatcaaaaagtttccgaccattgtg
cttctcccaggtggaggaaaagaagctatttcctacggtggagagttaaaaaagaatccg
atatctgattttctcggtcaggtagctaaagccagcacagatccaaaacccagcaaatct
acagcgtccactacctccgaggccaccgaatctccagagaccagttccagatctgtctct
cctttaccatccaaggcccctgctctaaacatcctatccacaacctcagaccttagaaag
gtgtgtctcgccccaaagacgggaacttgtgtcctcgtcctcggaaaaatgccagaatca
ttggattcagaacctccagctggagcatttcaggcattcaccggcctcgccgagatctcc
cataaacattcattgagaaagggacacctgttccccttttacgctgttccagatacagta
gaggatgttggtgtattaaggaataagctggagctgaagaaagacagcgtcattgatgtc
atcgctttgaatgcgaaacgcggctggtggcaacaatacgacccgggagaggaaggcgac
tttagcgccgccaaactcgaaacatggattgacgcgattcgtcttggagaaggagccaaa
aagaagctacccgatggcgttgtgttcgaggagcaagagaaagtgacagagccgacgaaa
gaacctgagaaagaggctgggatggagcccaaagttgaatcaccaaaagagccaaaacaa
aaacctgtaaaggaggaaccaaccagccataatgagctgtaa

DBGET integrated database retrieval system