KEGG   Paracoccidioides lutzii Pb01: PAAG_05575Help
Entry
PAAG_05575        CDS       T02230                                 

Definition
(RefSeq) hypothetical protein
  KO
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PAAG_05575
Enzymes [BR:pbl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PAAG_05575
Chaperones and folding catalysts [BR:pbl03110]
 Protein folding catalysts
  Protein disulfide isomerase
   PAAG_05575
Membrane trafficking [BR:pbl04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    PAAG_05575
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 469 aa AA seqDB search
MPKKSSAILLIAAFWQTLLVNVDGLYTKNSPVLQVDSSKYDHLIARSNQLSIVEFYAPWC
GHCQNLKPVYEKVAKHLDGLAQVAAVNCDDDLNKPICGQMGIRGFPTLKVITPSKKPGNP
RVEDYNGARTAKAIVEYMVDKIPNHVKKITDKEFDGWLKEANDTAKAILFTEKPATSALL
RALAIDYLGSINFAQIRNKETSAVQTFGIKKFPTIVLLPGGGKEAISYGGELKKNPISDF
LGQVAKASTDPKPSKSTASTTSEATESPETSSRSVSPLPSKAPALNILSTTSDLRKVCLA
PKTGTCVLVLGKMPESLDSEPPAGAFQAFTGLAEISHKHSLRKGHLFPFYAVPDTVEDVG
VLRNKLELKKDSVIDVIALNAKRGWWQQYDPGEEGDFSAAKLETWIDAIRLGEGAKKKLP
DGVVFEEQEKVTEPTKEPEKEAGMEPKVESPKEPKQKPVKEEPTSHNEL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagaagagctccgccattctgctaattgcagctttttggcagacactactcgta
aatgtcgacggtctttataccaaaaactctccagtcctccaagttgacagtagcaaatat
gaccatttgattgcgcggtcaaatcagttatctattgtagaattctacgctccatggtgt
ggacactgtcagaacttgaaacctgtatacgaaaaggttgccaagcaccttgatgggctg
gcacaagttgccgctgttaattgcgatgacgacttgaacaaacccatctgtggccagatg
ggaatccggggattccctactcttaaagtcataaccccgtcgaaaaagcccggaaaccca
cgagttgaagattataacggtgcgagaacggctaaagctatagttgaatatatggtggat
aagataccaaatcatgtaaaaaagattacagacaaggagttcgatggttggctaaaggaa
gcaaatgacactgcaaaagctattctgttcacagagaaacccgcgaccagtgcacttctc
cgggcgttagctatcgactatctagggtcaattaatttcgcacagattcgaaacaaagag
acttcagcggtacaaacctttggtatcaaaaagtttccgaccattgtgcttctcccaggt
ggaggaaaagaagctatttcctacggtggagagttaaaaaagaatccgatatctgatttt
ctcggtcaggtagctaaagccagcacagatccaaaacccagcaaatctacagcgtccact
acctccgaggccaccgaatctccagagaccagttccagatctgtctctcctttaccatcc
aaggcccctgctctaaacatcctatccacaacctcagaccttagaaaggtgtgtctcgcc
ccaaagacgggaacttgtgtcctcgtcctcggaaaaatgccagaatcattggattcagaa
cctccagctggagcatttcaggcattcaccggcctcgccgagatctcccataaacattca
ttgagaaagggacacctgttccccttttacgctgttccagatacagtagaggatgttggt
gtattaaggaataagctggagctgaagaaagacagcgtcattgatgtcatcgctttgaat
gcgaaacgcggctggtggcaacaatacgacccgggagaggaaggcgactttagcgccgcc
aaactcgaaacatggattgacgcgattcgtcttggagaaggagccaaaaagaagctaccc
gatggcgttgtgttcgaggagcaagagaaagtgacagagccgacgaaagaacctgagaaa
gaggctgggatggagcccaaagttgaatcaccaaaagagccaaaacaaaaacctgtaaag
gaggaaccaaccagccataatgagctgtaa

DBGET integrated database retrieval system